| UniProt ID | MTR2_YEAST | |
|---|---|---|
| UniProt AC | P34232 | |
| Protein Name | mRNA transport regulator MTR2 | |
| Gene Name | MTR2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 184 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Affects mRNA transport from the nucleus to the cytoplasm.. | |
| Protein Sequence | MNTNSNTMVMNDANQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDESGRDKMGQDATVPIQPNNTGNRNRPNDMNKPRPLWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPEDSLLKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MNTNSNTMVM -----CCCCCCCEEC | 38.43 | 30377154 | |
| 5 | Phosphorylation | ---MNTNSNTMVMND ---CCCCCCCEECCC | 31.47 | 30377154 | |
| 7 | Phosphorylation | -MNTNSNTMVMNDAN -CCCCCCCEECCCCC | 15.80 | 30377154 | |
| 19 | Phosphorylation | DANQAQITATFTKKI CCCHHHEEEEEHHHH | 13.94 | 30377154 | |
| 21 | Phosphorylation | NQAQITATFTKKILA CHHHEEEEEHHHHHH | 24.16 | 30377154 | |
| 23 | Phosphorylation | AQITATFTKKILAHL HHEEEEEHHHHHHCC | 27.37 | 30377154 | |
| 117 | Phosphorylation | DKMGQDATVPIQPNN CCCCCCCCCCCCCCC | 34.80 | 21126336 | |
| 125 | Phosphorylation | VPIQPNNTGNRNRPN CCCCCCCCCCCCCCC | 42.34 | 22369663 | |
| 167 | Phosphorylation | NDFNGVISGFNYNMV CCCCCCEECCCCEEE | 34.62 | 28889911 | |
| 175 | Phosphorylation | GFNYNMVYKPEDSLL CCCCEEEECCHHHCC | 15.28 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTR2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTR2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTR2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-125, AND MASSSPECTROMETRY. | |
