| UniProt ID | MSL1_YEAST | |
|---|---|---|
| UniProt AC | P40567 | |
| Protein Name | U2 small nuclear ribonucleoprotein B'' | |
| Gene Name | MSL1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 111 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds stem loop IV of U2 snRNA.. | |
| Protein Sequence | MVEPARKKQRIDRDTHHTVAEPVTEAKNTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETKTL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of MSL1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSL1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSL1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSL1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RU2A_YEAST | LEA1 | physical | 9799242 | |
| PT127_YEAST | PET127 | physical | 9207794 | |
| PT309_YEAST | PET309 | physical | 9207794 | |
| BAS1_YEAST | BAS1 | physical | 9207794 | |
| SN114_YEAST | SNU114 | physical | 9207794 | |
| LTE1_YEAST | LTE1 | physical | 9207794 | |
| ATR_YEAST | MEC1 | physical | 9207794 | |
| CAN_YEAST | NCE103 | physical | 9207794 | |
| SRS2_YEAST | SRS2 | physical | 9207794 | |
| RAD25_YEAST | SSL2 | physical | 9207794 | |
| SWI1_YEAST | SWI1 | physical | 9207794 | |
| RMD1_YEAST | RMD1 | physical | 9207794 | |
| LIC4_YEAST | ATC1 | physical | 9207794 | |
| TRA1_YEAST | TRA1 | physical | 9207794 | |
| RIX1_YEAST | RIX1 | physical | 9207794 | |
| NST1_YEAST | NST1 | physical | 9207794 | |
| AUS1_YEAST | AUS1 | physical | 9207794 | |
| YL456_YEAST | YLR456W | physical | 9207794 | |
| PP2B1_YEAST | CNA1 | physical | 9207794 | |
| RAD16_YEAST | RAD16 | physical | 9207794 | |
| NST1_YEAST | NST1 | genetic | 11816027 | |
| MSI1_YEAST | MSI1 | genetic | 17314980 | |
| HIR1_YEAST | HIR1 | genetic | 17314980 | |
| SWD3_YEAST | SWD3 | genetic | 17314980 | |
| CDC26_YEAST | CDC26 | genetic | 17314980 | |
| LTE1_YEAST | LTE1 | genetic | 17615297 | |
| SRS2_YEAST | SRS2 | genetic | 21459050 | |
| KASH5_HUMAN | CCDC155 | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
