| UniProt ID | RFA3_YEAST | |
|---|---|---|
| UniProt AC | P26755 | |
| Protein Name | Replication factor A protein 3 | |
| Gene Name | RFA3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 122 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | As part of the replication protein A (RPA/RP-A), a single-stranded DNA-binding heterotrimeric complex, may play an essential role in DNA replication, recombination and repair. Binds and stabilizes single-stranded DNA intermediates, preventing complementary DNA reannealing and recruiting different proteins involved in DNA metabolism (By similarity). Stimulates the activity of a cognate strand exchange protein (SEP1).. | |
| Protein Sequence | MASETPRVDPTEISNVNAPVFRIIAQIKSQPTESQLILQSPTISSKNGSEVEMITLNNIRVSMNKTFEIDSWYEFVCRNNDDGELGFLILDAVLCKFKENEDLSLNGVVALQRLCKKYPEIY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 29 | Phosphorylation | RIIAQIKSQPTESQL CHHHHHHCCCCCCEE | 42.92 | 22369663 | |
| 32 | Phosphorylation | AQIKSQPTESQLILQ HHHHCCCCCCEEEEE | 40.40 | 22369663 | |
| 34 | Phosphorylation | IKSQPTESQLILQSP HHCCCCCCEEEEECC | 32.53 | 22369663 | |
| 40 | Phosphorylation | ESQLILQSPTISSKN CCEEEEECCCEECCC | 22.14 | 22369663 | |
| 42 | Phosphorylation | QLILQSPTISSKNGS EEEEECCCEECCCCC | 38.44 | 22369663 | |
| 44 | Phosphorylation | ILQSPTISSKNGSEV EEECCCEECCCCCEE | 37.42 | 22369663 | |
| 45 | Phosphorylation | LQSPTISSKNGSEVE EECCCEECCCCCEEE | 26.70 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RFA3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RFA3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RFA3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
