UniProt ID | TAM41_YEAST | |
---|---|---|
UniProt AC | P53230 | |
Protein Name | Phosphatidate cytidylyltransferase, mitochondrial | |
Gene Name | TAM41 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 385 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side . |
|
Protein Description | Catalyzes the formation of CDP-diacylglycerol (CDP-DAG) from phosphatidic acid (PA) in the mitochondrial inner membrane. Required for the biosynthesis of the dimeric phospholipid cardiolipin, which stabilizes supercomplexes of the mitochondrial respiratory chain in the mitochondrial inner membrane.. | |
Protein Sequence | MLRVSENGLRFLLKCHSTNVSMFNRLLSTQIKEGRSSIDDAGIIPDGTINERPNHYIEGITKGSDLDLLEKGIRKTDEMTSNFTNYMYKFHRLPPNYGSNQLITIDKELQKELDGVMSSFKAPCRFVFGYGSGVFEQAGYSKSHSKPQIDIILGVTYPSHFHSINMRQNPQHYSSLKYFGSEFVSKFQQIGAGVYFNPFANINGHDVKYGVVSMETLLKDIATWNTFYLAGRLQKPVKILKNDLRVQYWNQLNLKAAATLAKHYTLEKNNNKFDEFQFYKEITALSYAGDIRYKLGGENPDKVNNIVTKNFERFQEYYKPIYKEVVLNDSFYLPKGFTLKNTQRLLLSRISKSSALQTIKGVFTAGITKSIKYAWAKKLKSMRRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MLRVSENGLRFL ---CCEECHHHHHHH | 20.93 | 27017623 | |
21 | Phosphorylation | KCHSTNVSMFNRLLS HHCCCCHHHHHHHHH | 21.52 | 27017623 | |
71 | Acetylation | SDLDLLEKGIRKTDE CCHHHHHHHCCCHHH | 60.65 | 24489116 | |
241 | Acetylation | QKPVKILKNDLRVQY CCCEEHHHCCHHHHH | 52.46 | 25381059 | |
308 | Phosphorylation | DKVNNIVTKNFERFQ HHHHHHHHCCHHHHH | 19.24 | 28132839 | |
368 | Phosphorylation | GVFTAGITKSIKYAW HHHHHHHHHHHHHHH | 20.16 | 28889911 | |
370 | Phosphorylation | FTAGITKSIKYAWAK HHHHHHHHHHHHHHH | 18.70 | 28889911 | |
373 | Phosphorylation | GITKSIKYAWAKKLK HHHHHHHHHHHHHHH | 13.00 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAM41_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAM41_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAM41_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...