| UniProt ID | SPG3_YEAST | |
|---|---|---|
| UniProt AC | Q04398 | |
| Protein Name | Stationary phase protein 3 | |
| Gene Name | SPG3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 127 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | Required for survival during stationary phase.. | |
| Protein Sequence | MICYFLVVTINFLKEKTTICHYFVNIFSLFLFLFVFVFVFIFVYFFYVILFYRFCSLFTYFPANSIWYYLSIINIFFPLCFFLYENFTGRNRRKCSLFCLTLIKITYTSPNHGFMVTGKEKFEKLRD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 86 | N-linked_Glycosylation | LCFFLYENFTGRNRR HHHHHHHHCCCCCHH | 26.65 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPG3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPG3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPG3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| STU1_YEAST | STU1 | genetic | 27708008 | |
| UAP1_YEAST | QRI1 | genetic | 27708008 | |
| CDC37_YEAST | CDC37 | genetic | 27708008 | |
| GNA1_YEAST | GNA1 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| ATC7_YEAST | NEO1 | genetic | 27708008 | |
| RPF2_YEAST | RPF2 | genetic | 27708008 | |
| SEC22_YEAST | SEC22 | genetic | 27708008 | |
| EI2BB_YEAST | GCD7 | genetic | 27708008 | |
| BUR1_YEAST | SGV1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...