SPG3_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPG3_YEAST
• UniProt AC: Q04398
• Protein Name: Stationary phase protein 3
• Gene Name: SPG3
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 127
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Required for survival during stationary phase..
• Protein Sequence: MICYFLVVTINFLKEKTTICHYFVNIFSLFLFLFVFVFVFIFVYFFYVILFYRFCSLFTYFPANSIWYYLSIINIFFPLCFFLYENFTGRNRRKCSLFCLTLIKITYTSPNHGFMVTGKEKFEKLRD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
86	N-linked_Glycosylation	LCFFLYENFTGRNRR HHHHHHHHCCCCCHH	26.65	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPG3_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPG3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPG3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
STU1_YEAST	STU1	genetic	27708008
UAP1_YEAST	QRI1	genetic	27708008
CDC37_YEAST	CDC37	genetic	27708008
GNA1_YEAST	GNA1	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
ATC7_YEAST	NEO1	genetic	27708008
RPF2_YEAST	RPF2	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
EI2BB_YEAST	GCD7	genetic	27708008
BUR1_YEAST	SGV1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.