| UniProt ID | GCST_YEAST | |
|---|---|---|
| UniProt AC | P48015 | |
| Protein Name | Aminomethyltransferase, mitochondrial | |
| Gene Name | GCV1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 400 | |
| Subcellular Localization | Mitochondrion. | |
| Protein Description | The glycine cleavage system (glycine decarboxylase complex) catalyzes the degradation of glycine.. | |
| Protein Sequence | MSIIKKIVFKRFNSTLKKTALHDLHVSLGGTMVPYAGYSMPVLYKGQTHIESHNWTRTNAGLFDVSHMLQSKLSGPHSVKFLQRVTPTDFNALPVGSGTLSVLLNPQGGVVDDTIITKENDDNEFYIVTNAGCAERDTEFFHDELQNGSTLDCQWKIIEGRSLLALQGPKAKDVLEPLLSKTAPGKDLKELFFGQRHEFALKDGSLVQIARGGYTGEDGFEISIANEKAVEFAEQLLANPVMKPIGLAARDSLRLEAGMCLYGHELDESITPVEAALNWVISKSRRDLVDQKYWFNGYAKIMDQLNNKTYSKVRVGFKYLKKGPAARNGVKIFLPDAETEVGLVTSGSASPTLNNINIGQAYVQKGYHKKGTKLLVQVRNKFYPIELAKMPLVPTHYYKQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 72 | Acetylation | VSHMLQSKLSGPHSV HHHHHHHHHCCCCHH | 33.44 | 24489116 | |
| 80 | Acetylation | LSGPHSVKFLQRVTP HCCCCHHEEHCCCCC | 43.29 | 24489116 | |
| 181 | Acetylation | VLEPLLSKTAPGKDL HHHHHHCCCCCCCCH | 48.99 | 24489116 | |
| 189 | Acetylation | TAPGKDLKELFFGQR CCCCCCHHHHHCCCE | 63.61 | 24489116 | |
| 202 | Acetylation | QRHEFALKDGSLVQI CEEEEEECCCCEEEE | 57.52 | 24489116 | |
| 292 | Acetylation | RRDLVDQKYWFNGYA HHHHCCCHHHHHHHH | 39.73 | 24489116 | |
| 308 | Succinylation | IMDQLNNKTYSKVRV HHHHHCCCCCCEEEE | 48.01 | 23954790 | |
| 381 | Acetylation | LLVQVRNKFYPIELA EEEEECCCCCCCCCC | 35.39 | 24489116 | |
| 389 | Acetylation | FYPIELAKMPLVPTH CCCCCCCCCCCCCCC | 54.39 | 24489116 | |
| 399 | Acetylation | LVPTHYYKQ------ CCCCCCCCC------ | 42.22 | 24489116 | |
| 399 | Succinylation | LVPTHYYKQ------ CCCCCCCCC------ | 42.22 | 23954790 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GCST_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GCST_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GCST_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
