RTPT_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RTPT_YEAST
• UniProt AC: P17558
• Protein Name: 37S ribosomal protein PET123, mitochondrial
• Gene Name: PET123
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 318
• Subcellular Localization: Mitochondrion . Mitoribosomes are tethered to the mitochondrial inner membrane and spatially aligned with the membrane insertion machinery through two distinct membrane contact sites, formed by the 21S rRNA expansion segment 96-ES1 and the inner memb
• Protein Description: Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane..
• Protein Sequence: MGKGAAKYGFKSGVFPTTRSILKSPTTKQTDIINKVKSPKPKGVLGIGYAKGVKHPKGSHRLSPKVNFIDVDNLIAKTVAEPQSIKSSNGSAQKVRLQKAELRRKFLIEAFRKEEARLLHKHEYLQKRTKELEKAKELELEKLNKEKSSDLTIMTLDKMMSQPLLRNRSPEESELLKLKRNYNRSLLNFQAHKKKLNELLNLYHVANEFIVTESQLLKKIDKVFNDETEEFTDAYDVTSNFTQFGNRKLLLSGNTTLQTQINNAIMGSLSNEKFFDISLVDSYLNKDLKNISNKIDSKLNPTSNGAGNNGNNNNTTNL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Phosphorylation	TTRSILKSPTTKQTD CCHHHHHCCCCCCCC	24.84	23749301
121	Acetylation	EEARLLHKHEYLQKR HHHHHHHHHHHHHHH	37.79	22865919
142	Acetylation	AKELELEKLNKEKSS HHHHHHHHHHHHHCC	70.73	24489116
155	Phosphorylation	SSDLTIMTLDKMMSQ CCCCEEEEHHHHHCC	28.14	27017623
169	Phosphorylation	QPLLRNRSPEESELL CHHHHCCCHHHHHHH	39.97	25704821
182	Phosphorylation	LLKLKRNYNRSLLNF HHHHHHHCCHHHHHH	18.91	19823750
185	Phosphorylation	LKRNYNRSLLNFQAH HHHHCCHHHHHHHHH	33.30	19823750
214	Phosphorylation	NEFIVTESQLLKKID HHHHCCHHHHHHHHH	19.43	27214570
302	Phosphorylation	IDSKLNPTSNGAGNN HHHCCCCCCCCCCCC	33.48	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RTPT_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RTPT_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RTPT_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RT05_YEAST	MRPS5	physical	16554755
RT24_YEAST	RSM24	physical	16554755
RT01_YEAST	MRP1	physical	16554755
RT13_YEAST	MRP13	physical	16554755
RT27_YEAST	RSM27	physical	16554755
RT04_YEAST	MRP4	physical	16554755
RT25_YEAST	RSM25	physical	16554755
RT26_YEAST	RSM26	physical	16554755
RT07_YEAST	RSM7	physical	16554755
RT18_YEAST	MRPS18	physical	16554755
RT19_YEAST	RSM19	physical	16554755
ATG17_YEAST	ATG17	physical	11283351
SP382_YEAST	SPP382	physical	11283351
ATG17_YEAST	ATG17	physical	18719252
COG2_YEAST	COG2	physical	18719252
RT01_YEAST	MRP1	genetic	1848523
RL36A_YEAST	RPL36A	genetic	29158977
DOM34_YEAST	DOM34	genetic	29158977

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.