| UniProt ID | NAT3_YEAST | |
|---|---|---|
| UniProt AC | Q06504 | |
| Protein Name | N-terminal acetyltransferase B complex catalytic subunit NAT3 | |
| Gene Name | NAT3 {ECO:0000312|SGD:S000006335} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 195 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Catalytic subunit of the NatB N-terminal acetyltransferase, which catalyzes acetylation of the amino-terminal methionine residues of all proteins beginning with Met-Asp or Met-Glu and of some proteins beginning with Met-Asn, Met-Gln or Met-Met. NatB acetylates TPM1 protein and regulates tropomyocin-actin interactions, it is presumed to N-acetylate 15% of all yeast proteins.. | |
| Protein Sequence | MTTIQPFEPVDLFKTNNVNLDILTENFPLEFYFEYMIIWPDLFFKSSEMTVDPTFKHNISGYMMAKTEGKTTEWHTHITAVTVAPRFRRISLASKLCNTLETMTDVMPHEVNFIDLFVKCNNQLAIKLYEKLGYSVYRRVVGYYNSAEDGYPDTLKKVDDNKDAFDMRKAMARDRNRSVRPDGRSHKCYPHDVRF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 131 | Acetylation | LAIKLYEKLGYSVYR HHHHHHHHHCHHHHH | 33.39 | 24489116 | |
| 156 | Acetylation | DGYPDTLKKVDDNKD CCCCCHHHCCCCCCC | 53.49 | 24489116 | |
| 169 | Acetylation | KDAFDMRKAMARDRN CCCHHHHHHHHHHCC | 35.56 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NAT3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NAT3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NAT3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NAA25_YEAST | MDM20 | physical | 14759368 | |
| NAT3_YEAST | NAT3 | physical | 14759368 | |
| NAA25_YEAST | MDM20 | physical | 12783868 | |
| PRS6B_YEAST | RPT3 | physical | 12504901 | |
| RPN11_YEAST | RPN11 | physical | 12504901 | |
| ACT_YEAST | ACT1 | genetic | 12783868 | |
| TPM1_YEAST | TPM1 | genetic | 12783868 | |
| NAA25_YEAST | MDM20 | physical | 16554755 | |
| HSP71_YEAST | SSA1 | physical | 19536198 | |
| MIG3_YEAST | MIG3 | genetic | 25163837 | |
| GAS5_YEAST | GAS5 | genetic | 25163837 | |
| VPS15_YEAST | VPS15 | genetic | 25163837 | |
| VAM10_YEAST | VAM10 | genetic | 27708008 | |
| DPOA2_YEAST | POL12 | genetic | 27708008 | |
| DPOD_YEAST | POL3 | genetic | 27708008 | |
| PRI2_YEAST | PRI2 | genetic | 27708008 | |
| NSE1_YEAST | NSE1 | genetic | 27708008 | |
| SMC6_YEAST | SMC6 | genetic | 27708008 | |
| DYR_YEAST | DFR1 | genetic | 27708008 | |
| ELO2_YEAST | ELO2 | genetic | 27708008 | |
| DBP7_YEAST | DBP7 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
