UniProt ID | NAT3_YEAST | |
---|---|---|
UniProt AC | Q06504 | |
Protein Name | N-terminal acetyltransferase B complex catalytic subunit NAT3 | |
Gene Name | NAT3 {ECO:0000312|SGD:S000006335} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 195 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Catalytic subunit of the NatB N-terminal acetyltransferase, which catalyzes acetylation of the amino-terminal methionine residues of all proteins beginning with Met-Asp or Met-Glu and of some proteins beginning with Met-Asn, Met-Gln or Met-Met. NatB acetylates TPM1 protein and regulates tropomyocin-actin interactions, it is presumed to N-acetylate 15% of all yeast proteins.. | |
Protein Sequence | MTTIQPFEPVDLFKTNNVNLDILTENFPLEFYFEYMIIWPDLFFKSSEMTVDPTFKHNISGYMMAKTEGKTTEWHTHITAVTVAPRFRRISLASKLCNTLETMTDVMPHEVNFIDLFVKCNNQLAIKLYEKLGYSVYRRVVGYYNSAEDGYPDTLKKVDDNKDAFDMRKAMARDRNRSVRPDGRSHKCYPHDVRF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
131 | Acetylation | LAIKLYEKLGYSVYR HHHHHHHHHCHHHHH | 33.39 | 24489116 | |
156 | Acetylation | DGYPDTLKKVDDNKD CCCCCHHHCCCCCCC | 53.49 | 24489116 | |
169 | Acetylation | KDAFDMRKAMARDRN CCCHHHHHHHHHHCC | 35.56 | 25381059 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NAT3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NAT3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NAT3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NAA25_YEAST | MDM20 | physical | 14759368 | |
NAT3_YEAST | NAT3 | physical | 14759368 | |
NAA25_YEAST | MDM20 | physical | 12783868 | |
PRS6B_YEAST | RPT3 | physical | 12504901 | |
RPN11_YEAST | RPN11 | physical | 12504901 | |
ACT_YEAST | ACT1 | genetic | 12783868 | |
TPM1_YEAST | TPM1 | genetic | 12783868 | |
NAA25_YEAST | MDM20 | physical | 16554755 | |
HSP71_YEAST | SSA1 | physical | 19536198 | |
MIG3_YEAST | MIG3 | genetic | 25163837 | |
GAS5_YEAST | GAS5 | genetic | 25163837 | |
VPS15_YEAST | VPS15 | genetic | 25163837 | |
VAM10_YEAST | VAM10 | genetic | 27708008 | |
DPOA2_YEAST | POL12 | genetic | 27708008 | |
DPOD_YEAST | POL3 | genetic | 27708008 | |
PRI2_YEAST | PRI2 | genetic | 27708008 | |
NSE1_YEAST | NSE1 | genetic | 27708008 | |
SMC6_YEAST | SMC6 | genetic | 27708008 | |
DYR_YEAST | DFR1 | genetic | 27708008 | |
ELO2_YEAST | ELO2 | genetic | 27708008 | |
DBP7_YEAST | DBP7 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...