DYDC1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DYDC1_HUMAN
• UniProt AC: Q8WWB3
• Protein Name: DPY30 domain-containing protein 1
• Gene Name: DYDC1
• Organism: Homo sapiens (Human).
• Sequence Length: 177
• Protein Description: Plays a crucial role during acrosome biogenesis..
• Protein Sequence: MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
40	Phosphorylation	LALWIYKYKENVTME HHHHHHHHHHCCCHH	13.43	29083192
45	Phosphorylation	YKYKENVTMEQLRQK HHHHHCCCHHHHHHH	26.94	29083192
167	Phosphorylation	ELDEPMFSDIALNID CCCCCCCHHHHHCCC	23.12	30622161

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DYDC1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DYDC1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DYDC1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TXLNB_HUMAN	TXLNB	physical	25416956
CE57L_HUMAN	CEP57L1	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.