UniProt ID | DYDC1_HUMAN | |
---|---|---|
UniProt AC | Q8WWB3 | |
Protein Name | DPY30 domain-containing protein 1 | |
Gene Name | DYDC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 177 | |
Subcellular Localization | ||
Protein Description | Plays a crucial role during acrosome biogenesis.. | |
Protein Sequence | MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Phosphorylation | LALWIYKYKENVTME HHHHHHHHHHCCCHH | 13.43 | 29083192 | |
45 | Phosphorylation | YKYKENVTMEQLRQK HHHHHCCCHHHHHHH | 26.94 | 29083192 | |
167 | Phosphorylation | ELDEPMFSDIALNID CCCCCCCHHHHHCCC | 23.12 | 30622161 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DYDC1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DYDC1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DYDC1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TXLNB_HUMAN | TXLNB | physical | 25416956 | |
CE57L_HUMAN | CEP57L1 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...