| UniProt ID | CWC24_YEAST | |
|---|---|---|
| UniProt AC | P53769 | |
| Protein Name | Pre-mRNA-splicing factor CWC24 | |
| Gene Name | CWC24 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 259 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Involved in pre-mRNA splicing.. | |
| Protein Sequence | MFRKRLVNKSSSDEKNQKKRQKINFSEEKLVASDEEKGSSDLMSLAKSGNSRTLQLSHENEGKLQKKGEDLDKYTLTVNDDSTKEDLLNFERKELAEKAKKRRPSDDNELVLNMSGKNKRLTKQINQPTNIRTTVLMDFQPDVCKDYKQTGYCGYGDSCKFLHSRDDFKTGWKLNQEWNADKEDSKAVTLDLEKIPFKCTLCKEDYKSPVVTNCGHYFCGSCFAKDMKKGTKCFICHKETHGSAKVASDLQKMLNKRKS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | Phosphorylation | KRQKINFSEEKLVAS HHHCCCCCHHHHHCC | 40.12 | 27214570 | |
| 33 | Phosphorylation | SEEKLVASDEEKGSS CHHHHHCCCCCCCCH | 37.77 | 22369663 | |
| 39 | Phosphorylation | ASDEEKGSSDLMSLA CCCCCCCCHHHHHHH | 31.57 | 29688323 | |
| 40 | Phosphorylation | SDEEKGSSDLMSLAK CCCCCCCHHHHHHHH | 43.35 | 21440633 | |
| 43 | Oxidation | EKGSSDLMSLAKSGN CCCCHHHHHHHHHCC | 3.56 | 15665377 | |
| 44 | Phosphorylation | KGSSDLMSLAKSGNS CCCHHHHHHHHHCCC | 32.26 | 29688323 | |
| 74 | Phosphorylation | KGEDLDKYTLTVNDD CCCCCCCEEEEECCC | 13.47 | 26447709 | |
| 75 | Phosphorylation | GEDLDKYTLTVNDDS CCCCCCEEEEECCCC | 22.99 | 26447709 | |
| 77 | Phosphorylation | DLDKYTLTVNDDSTK CCCCEEEEECCCCCH | 14.95 | 26447709 | |
| 105 | Phosphorylation | KAKKRRPSDDNELVL HHHHCCCCCCCCEEE | 56.64 | 22369663 | |
| 115 | Phosphorylation | NELVLNMSGKNKRLT CCEEECCCCCCHHHH | 45.61 | 22369663 | |
| 123 | Acetylation | GKNKRLTKQINQPTN CCCHHHHHHHCCCCC | 54.49 | 25381059 | |
| 194 | Acetylation | AVTLDLEKIPFKCTL CEEEEHHHCCCEEEE | 64.08 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWC24_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWC24_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWC24_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33, AND MASSSPECTROMETRY. | |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-105, AND MASSSPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33, AND MASSSPECTROMETRY. | |
| "Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33, AND MASSSPECTROMETRY. | |
