| UniProt ID | SYM1_YEAST | |
|---|---|---|
| UniProt AC | Q06563 | |
| Protein Name | Protein SYM1 | |
| Gene Name | SYM1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 197 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
| Protein Description | May be involved in cellular response to stress. Required to maintain mitochondrial DNA (mtDNA) integrity and stability. Required for ethanol metabolism and tolerance during heat shock.. | |
| Protein Sequence | MKLLHLYEASLKRRPKTTNAIMTGALFGIGDVSAQLLFPTSKVNKGYDYKRTARAVIYGSLIFSFIGDKWYKILNNKIYMRNRPQYHWSNMVLRVAVDQLAFAPLGLPFYFTCMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVNVVAIFWNTYLSYKNSKVMEKDKVPVHYPPVVE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYM1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYM1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYM1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| YMC1_YEAST | YMC1 | genetic | 20042463 | |
| ODC1_YEAST | ODC1 | genetic | 20042463 | |
| CISY1_YEAST | CIT1 | genetic | 20042463 | |
| CISY2_YEAST | CIT2 | genetic | 20042463 | |
| REI1_YEAST | REI1 | genetic | 20093466 | |
| RV161_YEAST | RVS161 | genetic | 20093466 | |
| DCOR_YEAST | SPE1 | genetic | 20093466 | |
| RL14A_YEAST | RPL14A | genetic | 20093466 | |
| DNM1_YEAST | DNM1 | genetic | 20093466 | |
| RSSA2_YEAST | RPS0B | genetic | 20093466 | |
| BRE5_YEAST | BRE5 | genetic | 20093466 | |
| YAR1_YEAST | YAR1 | genetic | 20093466 | |
| RL21B_YEAST | RPL21B | genetic | 20093466 | |
| TOM22_YEAST | TOM22 | physical | 23045398 | |
| TOM40_YEAST | TOM40 | physical | 23045398 | |
| TOM20_YEAST | TOM20 | physical | 23045398 | |
| TOM5_YEAST | TOM5 | physical | 23045398 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...