| UniProt ID | TIM8_YEAST | |
|---|---|---|
| UniProt AC | P57744 | |
| Protein Name | Mitochondrial import inner membrane translocase subunit TIM8 | |
| Gene Name | TIM8 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 87 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . Mitochondrion intermembrane space . Import into inner membrane protein requires TIM5 function. |
|
| Protein Description | Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins under precise conditions, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins. Strictly required for import of TIM23 in some conditions, when a low membrane potential exists in the mitochondria.. | |
| Protein Sequence | MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSSLSTSDL ------CCCCCHHHH | 39.73 | 28889911 | |
| 3 | Phosphorylation | -----MSSLSTSDLA -----CCCCCHHHHH | 25.66 | 19823750 | |
| 5 | Phosphorylation | ---MSSLSTSDLASL ---CCCCCHHHHHCC | 28.01 | 28889911 | |
| 6 | Phosphorylation | --MSSLSTSDLASLD --CCCCCHHHHHCCC | 31.39 | 19823750 | |
| 7 | Phosphorylation | -MSSLSTSDLASLDD -CCCCCHHHHHCCCC | 27.53 | 19823750 | |
| 11 | Phosphorylation | LSTSDLASLDDTSKK CCHHHHHCCCCCCHH | 39.36 | 28889911 | |
| 15 | Phosphorylation | DLASLDDTSKKEIAT HHHCCCCCCHHHHHH | 41.95 | 19823750 | |
| 16 | Phosphorylation | LASLDDTSKKEIATF HHCCCCCCHHHHHHH | 49.04 | 19823750 | |
| 36 | Phosphorylation | SKQKVQMSIHQFTNI CHHHHHHHHHHHHHH | 10.38 | 30377154 | |
| 58 | Phosphorylation | SVNDSNLSSQEEQCL HCCCCCCCHHHHHHH | 33.94 | 30377154 | |
| 59 | Phosphorylation | VNDSNLSSQEEQCLS CCCCCCCHHHHHHHH | 44.79 | 28889911 | |
| 66 | Phosphorylation | SQEEQCLSNCVNRFL HHHHHHHHHHHHHHH | 35.49 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM8_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM8_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM8_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
