dbPTM

HAT1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HAT1_SCHPO
UniProt AC	Q9UTM7
Protein Name	Histone acetyltransferase type B catalytic subunit
Gene Name	hat1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	378
Subcellular Localization	Cytoplasm. Nucleus.
Protein Description	Catalytic component of the histone acetylase B (HAT-B) complex. Acetylates 'Lys-12' of histone H4 which is required for telomeric silencing. Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. Involved in DNA double-strand break repair..
Protein Sequence	MSAVDEWVHNANECIEIVQVNEKHEKDCQYHPSNTYAIFGDAEVIYGYKDLNVTITYECPLMVPKLEISYSERLAPDSGVEPTDIEGTLNTYLKDRSIKVEGNSFDVHSANSIHNYSFNGKTFKILQATVLEASEIMQHLQIFSLFFIEGGSFIDLNDPRWMVYLLYETTEDDYCLRGYCTVYKYYKWDKLIHDGIRARISQFVILPPFQHQGHGSQLYNAIVSTFLKNPKILDFTVEDASEAFDSLRDHCDYKRLLSMGIFSEPDFHPSLSRQWINSKIAETKLTQRQFSRCCELAFTTKLKKLSLLERKSVRLGIKERIFRQNLDVLLQLDKSERIEKIHNAYENQFDEYKQIVKKLPKLKEDSPRKRQKLAQSSS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
366	Phosphorylation	LPKLKEDSPRKRQKL HHHHCCCCHHHHHHH	27.91	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HAT1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HAT1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HAT1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EAF3_SCHPO	alp13	genetic	19547744
SIR2_SCHPO	sir2	genetic	19547744
HAT2_SCHPO	mis16	physical	22771823
H4_SCHPO	hhf3	physical	22771823
HAT2_SCHPO	mis16	physical	24789708
HAT2_SCHPO	mis16	physical	24774534

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HAT1_SCHPO

Related Literatures of Post-Translational Modification