| UniProt ID | MNN1_YEAST | |
|---|---|---|
| UniProt AC | P39106 | |
| Protein Name | Alpha-1,3-mannosyltransferase MNN1 | |
| Gene Name | MNN1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 762 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein . |
|
| Protein Description | Responsible for addition of the terminal mannose residues to the outer chain of core N-linked polysaccharides and to O-linked mannotriose. Implicated in late Golgi modifications.. | |
| Protein Sequence | MLALRRFILNQRSLRSCTIPILVGALIIILVLFQLVTHRNDALIRSSNVNSTNKKTLKDADPKVLIEAFGSPEVDPVDTIPVSPLELVPFYDQSIDTKRSSSWLINKKGYYKHFNELSLTDRCKFYFRTLYTLDDEWTNSVKKLEYSINDNEGVDEGKDANGNPMDEKSERLYRRKYDMFQAFERIRAYDRCFMQANPVNIQEIFPKSDKMSKERVQSKLIKTLNATFPNYDPDNFKKYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYEYDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDELSQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLLPRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKRQEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAKDDWKKDGDFKKFKDQFKTFEEMEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGELITLDEEQRLHIDAVNTVWSHANKDNTRSFTEEEIKELENSRHEQS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 50 | N-linked_Glycosylation | LIRSSNVNSTNKKTL HHHCCCCCCCCCCCC | 47.57 | - | |
| 56 | Phosphorylation | VNSTNKKTLKDADPK CCCCCCCCCCCCCHH | 40.42 | 27017623 | |
| 112 | Acetylation | INKKGYYKHFNELSL ECCCCCHHCCCCCCC | 32.98 | 24489116 | |
| 225 | N-linked_Glycosylation | SKLIKTLNATFPNYD HHHHHHHHHCCCCCC | 42.01 | - | |
| 254 | N-linked_Glycosylation | KMFPFINNFTTETFH HCCHHHCCCCHHHHH | 30.72 | - | |
| 282 | Acetylation | LEQGFLPKFDHKTGK HHCCCCCCCCCCCCC | 66.62 | 24489116 | |
| 383 | N-linked_Glycosylation | PVENNYDNSTNVPQE CCCCCCCCCCCCCCE | 40.13 | - | |
| 660 | Acetylation | KTFEEMEKYYYITPI HCHHHHHHHEEEEEC | 36.92 | 24489116 | |
| 678 | Acetylation | YVILPDPKSDDWHRA EEEECCCCCCCCHHC | 74.11 | 24489116 | |
| 704 | Acetylation | ATHKTLLKPYSYNHR EECCCCCCCCCCCCC | 45.05 | 24489116 | |
| 757 | Phosphorylation | EIKELENSRHEQS-- HHHHHHHHHHCCC-- | 26.16 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MNN1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MNN1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MNN1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ANP1_YEAST | ANP1 | physical | 10037752 | |
| YPS7_YEAST | YPS7 | genetic | 16269340 | |
| PIL1_YEAST | PIL1 | genetic | 16269340 | |
| COG7_YEAST | COG7 | genetic | 16269340 | |
| YJY5_YEAST | YJR015W | genetic | 16269340 | |
| ERG4_YEAST | ERG4 | genetic | 16269340 | |
| EUG1_YEAST | EUG1 | genetic | 16269340 | |
| OCH1_YEAST | OCH1 | genetic | 17661134 | |
| SSB1_YEAST | SSB1 | physical | 22940862 | |
| RL19A_YEAST | RPL19B | genetic | 27708008 | |
| RL19B_YEAST | RPL19B | genetic | 27708008 | |
| REI1_YEAST | REI1 | genetic | 27708008 | |
| RV161_YEAST | RVS161 | genetic | 27708008 | |
| RLA1_YEAST | RPP1A | genetic | 27708008 | |
| OST4_YEAST | OST4 | genetic | 27708008 | |
| RV167_YEAST | RVS167 | genetic | 27708008 | |
| IES1_YEAST | IES1 | genetic | 27708008 | |
| HUR1_YEAST | HUR1 | genetic | 27708008 | |
| ICE2_YEAST | ICE2 | genetic | 27708008 | |
| COX7_YEAST | COX7 | genetic | 27708008 | |
| VPS27_YEAST | VPS27 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
