dbPTM

YB255_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YB255_YEAST
UniProt AC	Q3E776
Protein Name	Uncharacterized protein YBR255C-A
Gene Name	YBR255C-A
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	120
Subcellular Localization	Membrane Single-pass membrane protein .
Protein Description
Protein Sequence	MGGNVLPIHYDPKTVKQLTKEITVASCIGAAQGALFSIASALLLRRFSSVYRNVRTQVRVFYHCSWISMGAVFRADKQLLKFQTNYYREEQKRREKIMDEAAERGLFLEDESLNSSRSTT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
114	N-linked_Glycosylation	FLEDESLNSSRSTT- CCCCCHHCCCCCCC-	47.41	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YB255_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YB255_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YB255_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MNS1_YEAST	MNS1	physical	18467557
MSB2_YEAST	MSB2	physical	18467557
AIM26_YEAST	AIM26	physical	18467557
ABM1_YEAST	ABM1	physical	18467557
COX1_YEAST	COX1	physical	27662906
CY1_YEAST	CYT1	physical	27662906
QCR8_YEAST	QCR8	physical	27662906
COX2_YEAST	COX2	physical	27662906
UCRI_YEAST	RIP1	physical	27662906
RCF1_YEAST	RCF1	physical	27662906
RCF2_YEAST	RCF2	physical	27662906
SPO11_YEAST	SPO11	genetic	27708008
YHE4_YEAST	YHL044W	genetic	27708008
YHK8_YEAST	YHK8	genetic	27708008
TCTP_YEAST	TMA19	genetic	27708008
YRA2_YEAST	YRA2	genetic	27708008
RSF1_YEAST	RSF1	genetic	27708008
INO4_YEAST	INO4	genetic	27708008
IPYR_YEAST	IPP1	genetic	27708008
APC11_YEAST	APC11	genetic	27708008
SRPR_YEAST	SRP101	genetic	27708008
CCA1_YEAST	CCA1	genetic	27708008
PAN1_YEAST	PAN1	genetic	27708008
TIM16_YEAST	PAM16	genetic	27708008
CAP_YEAST	SRV2	genetic	27708008
PRS10_YEAST	RPT4	genetic	27708008
HRR25_YEAST	HRR25	genetic	27708008
SEC23_YEAST	SEC23	genetic	27708008
MAF1_YEAST	MAF1	genetic	27708008
PEX5_YEAST	PEX5	genetic	27708008
SLI1_YEAST	SLI1	genetic	27708008
MED20_YEAST	SRB2	genetic	27708008
SKN7_YEAST	SKN7	genetic	27708008
RGI2_YEAST	RGI2	genetic	27708008
BCK1_YEAST	BCK1	genetic	27708008
IME2_YEAST	IME2	genetic	27708008
IXR1_YEAST	IXR1	genetic	27708008
MUD2_YEAST	MUD2	genetic	27708008
SDHA_YEAST	SDH1	genetic	27708008
ENT4_YEAST	ENT4	genetic	27708008
ATG26_YEAST	ATG26	genetic	27708008
FKBP4_YEAST	FPR4	genetic	27708008
PUR92_YEAST	ADE17	genetic	27708008
PET20_YEAST	PET20	genetic	27708008
PHSG_YEAST	GPH1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YB255_YEAST

Related Literatures of Post-Translational Modification