| UniProt ID | ISD11_YEAST | |
|---|---|---|
| UniProt AC | Q6Q560 | |
| Protein Name | Protein ISD11 | |
| Gene Name | ISD11 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 94 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Required for mitochondrial iron-sulfur proteins biosynthesis.. | |
| Protein Sequence | MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Acetylation | RQVLSLYKEFIKNAN HHHHHHHHHHHHCCH | 51.98 | 24489116 | |
| 21 | Acetylation | SLYKEFIKNANQFNN HHHHHHHHCCHHHCC | 56.16 | 24489116 | |
| 38 | Acetylation | FREYFLSKTRTTFRK HHHHHHHHHHHHHHH | 44.14 | 24489116 | |
| 53 | Acetylation | NMNQQDPKVLMNLFK HCCCCCHHHHHHHHH | 57.18 | 24489116 | |
| 60 | Acetylation | KVLMNLFKEAKNDLG HHHHHHHHHHHHHHC | 60.99 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ISD11_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ISD11_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ISD11_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
