UniProt ID | ACPM_YEAST | |
---|---|---|
UniProt AC | P32463 | |
Protein Name | Acyl carrier protein, mitochondrial | |
Gene Name | ACP1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 125 | |
Subcellular Localization | Mitochondrion. | |
Protein Description | Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of very-long-chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity).. | |
Protein Sequence | MFRSVCRISSRVAPSAYRTIMGRSVMSNTILAQRFYSANLSKDQVSQRVIDVIKAFDKNSPNIANKQISSDTQFHKDLGLDSLDTVELLVAIEEEFDIEIPDKVADELRSVGETVDYIASNPDAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Phosphorylation | YRTIMGRSVMSNTIL HHHHHCCHHHCCHHH | 19.22 | 28889911 | |
27 | Phosphorylation | IMGRSVMSNTILAQR HHCCHHHCCHHHHHH | 28.76 | 27017623 | |
54 | Acetylation | QRVIDVIKAFDKNSP HHHHHHHHHHCCCCC | 42.73 | 24489116 | |
58 | Acetylation | DVIKAFDKNSPNIAN HHHHHHCCCCCCHHC | 53.52 | 22865919 | |
60 | Phosphorylation | IKAFDKNSPNIANKQ HHHHCCCCCCHHCCC | 25.68 | 21082442 | |
66 | Acetylation | NSPNIANKQISSDTQ CCCCHHCCCCCCCCH | 39.73 | 24489116 | |
66 | 2-Hydroxyisobutyrylation | NSPNIANKQISSDTQ CCCCHHCCCCCCCCH | 39.73 | - | |
69 | Phosphorylation | NIANKQISSDTQFHK CHHCCCCCCCCHHHH | 21.48 | 22369663 | |
70 | Phosphorylation | IANKQISSDTQFHKD HHCCCCCCCCHHHHH | 46.43 | 22369663 | |
72 | Phosphorylation | NKQISSDTQFHKDLG CCCCCCCCHHHHHCC | 34.77 | 22369663 | |
82 | O-(pantetheine 4'-phosphoryl)serine | HKDLGLDSLDTVELL HHHCCCCCCCHHHHH | 32.94 | - | |
82 | Phosphorylation | HKDLGLDSLDTVELL HHHCCCCCCCHHHHH | 32.94 | - | |
110 | Phosphorylation | KVADELRSVGETVDY HHHHHHHHHHCHHHH | 47.28 | 28889911 | |
120 | Phosphorylation | ETVDYIASNPDAN-- CHHHHHHCCCCCC-- | 39.06 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACPM_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACPM_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACPM_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBP2_YEAST | UBP2 | physical | 18719252 | |
MDHM_YEAST | MDH1 | genetic | 16941010 | |
NDI1_YEAST | NDI1 | genetic | 16941010 | |
OAC1_YEAST | OAC1 | genetic | 16941010 | |
EFS_HUMAN | EFS | physical | 27107014 | |
F193B_HUMAN | FAM193B | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...