dbPTM

PET54_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PET54_YEAST
UniProt AC	P10834
Protein Name	Protein PET54
Gene Name	PET54
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	293
Subcellular Localization	Mitochondrion inner membrane Peripheral membrane protein .
Protein Description	Activator of specific mitochondrial mRNAs. PET54 is involved in the excision of intron aI5-beta from pre-mRNA for cytochrome c oxidase I (COX1) and plays a role in promoting the translation of COX3..
Protein Sequence	MKASSKAIKLVLDHLKSTGRVLGSVESGNSATISEKTASVNKQQQLQEKKPSVLQYRSYNPYLVKEDFLSILPENLYKKRGQFTNELDFQLMKVRDPKYFQFKDQYYLFFNDYNSLTEYIKLTKHSRINKIRVKMTPLAQPLPTLLTKLQRYSKNLYNAFRSSEQYFEGLNEKVDVSGEFTTNQLRSILDSVEEIENKSVLVWNIPTKLRSHDILNYFWFYNIRSSFKIYWDDEMKRNLRFISFENSHDAYRFKRNYHGLLAKELLTLSEKGDAADYSLEMDDSKILIEHLSE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
148	Acetylation	PLPTLLTKLQRYSKN CHHHHHHHHHHHHHH	42.46	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PET54_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PET54_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PET54_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PT122_YEAST	PET122	physical	8289785
PT122_YEAST	PET122	genetic	8289785
COX3_YEAST	COX3	genetic	3030734
COX1_YEAST	COX1	physical	18388132
COX3_YEAST	COX3	physical	18388132
PSA1_YEAST	SCL1	genetic	27708008
HSP77_YEAST	SSC1	genetic	27708008
MED10_YEAST	NUT2	genetic	27708008
IPYR_YEAST	IPP1	genetic	27708008
POP7_YEAST	POP7	genetic	27708008
TSC10_YEAST	TSC10	genetic	27708008
KIN28_YEAST	KIN28	genetic	27708008
TIM22_YEAST	TIM22	genetic	27708008
STN1_YEAST	STN1	genetic	27708008
PCF11_YEAST	PCF11	genetic	27708008
PSB3_YEAST	PUP3	genetic	27708008
RSP5_YEAST	RSP5	genetic	27708008
CCA1_YEAST	CCA1	genetic	27708008
YPT1_YEAST	YPT1	genetic	27708008
MCE1_YEAST	CEG1	genetic	27708008
ATC7_YEAST	NEO1	genetic	27708008
TIM16_YEAST	PAM16	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
COFI_YEAST	COF1	genetic	27708008
RU1C_YEAST	YHC1	genetic	27708008
LST8_YEAST	LST8	genetic	27708008
ARPC2_YEAST	ARC35	genetic	27708008
SYQ_YEAST	GLN4	genetic	27708008
LAS17_YEAST	LAS17	genetic	27708008
PRS10_YEAST	RPT4	genetic	27708008
TFC8_YEAST	TFC8	genetic	27708008
CET1_YEAST	CET1	genetic	27708008
PT111_YEAST	PET111	genetic	26929411
MSS51_YEAST	MSS51	genetic	26929411
PT122_YEAST	PET122	physical	26929411
COX1_YEAST	COX1	physical	26929411
COX3_YEAST	COX3	physical	26929411
RL36A_YEAST	RPL36A	genetic	29158977
DOM34_YEAST	DOM34	genetic	29158977

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PET54_YEAST

Related Literatures of Post-Translational Modification