YD19A_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YD19A_YEAST
• UniProt AC: Q2V2P9
• Protein Name: Uncharacterized protein YDR119W-A
• Gene Name: YDR119W-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 66
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFFSKARKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YD19A_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YD19A_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YD19A_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YD19A_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
COX1_YEAST	COX1	physical	27083394
COX5A_YEAST	COX5A	physical	27083394
COX5B_YEAST	COX5B	physical	27083394
COX4_YEAST	COX4	physical	27083394
COX13_YEAST	COX13	physical	27083394
QCR8_YEAST	QCR8	physical	27083394
UCRI_YEAST	RIP1	physical	27083394
COX2_YEAST	COX2	physical	27091403

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.