dbPTM

YD381_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YD381_YEAST
UniProt AC	Q3E6R5
Protein Name	Uncharacterized mitochondrial outer membrane protein YDR381C-A
Gene Name	YDR381C-A
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	114
Subcellular Localization	Mitochondrion outer membrane Single-pass membrane protein .
Protein Description
Protein Sequence	MSNPFQNIGKNLLYISAAGIASIYVVKTIVKARRDAKFIPKARGNNGEVNEKNYYDNLAQVKPGFPIPKDGGDNIDCSEDHQLVRKSKYEGSGLSAVTRKRGDKLGFLDRRRNE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
24	Phosphorylation	AAGIASIYVVKTIVK HHHHHHEEHHHHHHH	9.19	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YD381_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YD381_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YD381_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YL012_YEAST	YLR012C	genetic	27708008
SEI1_YEAST	FLD1	genetic	27708008
DGK1_YEAST	DGK1	genetic	27708008
CALM_YEAST	CMD1	genetic	27708008
MAK5_YEAST	MAK5	genetic	27708008
MED8_YEAST	MED8	genetic	27708008
CDC10_YEAST	CDC10	genetic	27708008
MPS1_YEAST	MPS1	genetic	27708008
UAP1_YEAST	QRI1	genetic	27708008
GLE1_YEAST	GLE1	genetic	27708008
TIM22_YEAST	TIM22	genetic	27708008
SLU7_YEAST	SLU7	genetic	27708008
RSP5_YEAST	RSP5	genetic	27708008
TBP_YEAST	SPT15	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
DUO1_YEAST	DUO1	genetic	27708008
SYMC_YEAST	MES1	genetic	27708008
PAN1_YEAST	PAN1	genetic	27708008
TIM16_YEAST	PAM16	genetic	27708008
CWC16_YEAST	YJU2	genetic	27708008
COFI_YEAST	COF1	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
LST8_YEAST	LST8	genetic	27708008
EI2BG_YEAST	GCD1	genetic	27708008
DIB1_YEAST	DIB1	genetic	27708008
RMD9L_YEAST	YBR238C	genetic	27708008
MGR1_YEAST	MGR1	genetic	27708008
SLX5_YEAST	SLX5	genetic	27708008
PEX19_YEAST	PEX19	genetic	27708008
ECM32_YEAST	ECM32	genetic	27708008
MMS2_YEAST	MMS2	genetic	27708008
ARO8_YEAST	ARO8	genetic	27708008
RS23A_YEAST	RPS23A	genetic	27708008
RS23B_YEAST	RPS23A	genetic	27708008
UBCX_YEAST	PEX4	genetic	27708008
GOSR1_YEAST	GOS1	genetic	27708008
VPS53_YEAST	VPS53	genetic	27708008
NNK1_YEAST	NNK1	genetic	27708008
DCOR_YEAST	SPE1	genetic	27708008
FMP46_YEAST	FMP46	genetic	27708008
YL053_YEAST	YLR053C	genetic	27708008
PEX13_YEAST	PEX13	genetic	27708008
UPS1_YEAST	UPS1	genetic	27708008
FKS1_YEAST	FKS1	genetic	27708008
IMDH3_YEAST	IMD3	genetic	27708008
YMP0_YEAST	YMR010W	genetic	27708008
PEX12_YEAST	PEX12	genetic	27708008
ATP23_YEAST	ATP23	genetic	27708008
YO087_YEAST	DUF1	genetic	27708008
THP3_YEAST	THP3	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YD381_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-24, AND MASSSPECTROMETRY.	18407956 [Abstract]