YCZ1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YCZ1_YEAST
• UniProt AC: P25607
• Protein Name: Uncharacterized protein YCR101C
• Gene Name: YCR101C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 182
• Protein Sequence: MILLHAIYTLWVIILLPLLNAEKFVPKVTEAPIETSFNLVSFDDSNTSIRLDGWGVVWISFDAGENWETVKEIEERIFRFTVDPFHGQERGFAFICESPKFYITDDRGESWRALTIPSSEEYLDGDCFITTHPRNKELLIANCYSYMIDADVLYDPSEIYLSNDGNPFLKLNLPWKRKKTTI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
100	Ubiquitination	AFICESPKFYITDDR EEEECCCCEEEECCC	61.14	17644757

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YCZ1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YCZ1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YCZ1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MOB2_YEAST	MOB2	genetic	27708008
SMC3_YEAST	SMC3	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
BET3_YEAST	BET3	genetic	27708008
MED14_YEAST	RGR1	genetic	27708008
MCM1_YEAST	MCM1	genetic	27708008
RNA1_YEAST	RNA1	genetic	27708008
MED4_YEAST	MED4	genetic	27708008
TF2B_YEAST	SUA7	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.