UniProt ID | BSC2_YEAST | |
---|---|---|
UniProt AC | Q05611 | |
Protein Name | Bypass of stop codon protein 2 | |
Gene Name | BSC2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 235 | |
Subcellular Localization |
Lipid droplet . Membrane Single-pass membrane protein . Punctate lipid particles. |
|
Protein Description | ||
Protein Sequence | MFFFPKLRKLIGSTVIDHDTKNSSGKEEIMSNSRLALVIINHAFDKVLSLTWHCGILSEIRSGLMLMFGIFQLMCSLGVIVLLLPIIILDAIDLFLYMCRLLDYGCKLFHYNRSSLPVADGKEKTSGPISGKEEIVIDEEIINMLNESSESLINHTTAGLEYDISSGSVNKSRRLNSTSTVTFVKQNKLVNERREDAYYEEEDDDFLSNPNYDKISLIEKSFTSRFEVACEQKAA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Phosphorylation | KLRKLIGSTVIDHDT HHHHHHCCEEECCCC | 16.71 | 28889911 | |
177 | Phosphorylation | NKSRRLNSTSTVTFV CCCCCCCCCCEEEEE | 28.46 | 28152593 | |
180 | Phosphorylation | RRLNSTSTVTFVKQN CCCCCCCEEEEEECC | 24.53 | 25752575 | |
216 | Phosphorylation | NPNYDKISLIEKSFT CCCCCHHEEEHHHHH | 29.09 | 19779198 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BSC2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BSC2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BSC2_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-177, AND MASSSPECTROMETRY. |