UniProt ID | YN034_YEAST | |
---|---|---|
UniProt AC | Q3E841 | |
Protein Name | Uncharacterized protein YNR034W-A | |
Gene Name | YNR034W-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 98 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MKSSIPITEVLPRAVGSLTFDENYNLLDTSGVAKVIEKSPIAEIIRKSNAELGRLGYSVYEDAQYIGHAFKKAGHFIVYFTPKNKNREGVVPPVGITN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MKSSIPITEV -----CCCCCCHHHH | 32.00 | 22369663 | |
4 | Phosphorylation | ----MKSSIPITEVL ----CCCCCCHHHHH | 27.19 | 22369663 | |
8 | Phosphorylation | MKSSIPITEVLPRAV CCCCCCHHHHHCCCC | 18.06 | 22369663 | |
17 | Phosphorylation | VLPRAVGSLTFDENY HHCCCCCCCEECCCC | 20.03 | 30377154 | |
19 | Phosphorylation | PRAVGSLTFDENYNL CCCCCCCEECCCCCE | 30.64 | 28889911 | |
38 | 2-Hydroxyisobutyrylation | GVAKVIEKSPIAEII CHHHHHCCCCHHHHH | 50.86 | - | |
39 | Phosphorylation | VAKVIEKSPIAEIIR HHHHHCCCCHHHHHH | 14.56 | 29136822 | |
72 | 2-Hydroxyisobutyrylation | YIGHAFKKAGHFIVY HHHHHHHHCCEEEEE | 53.82 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YN034_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YN034_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YN034_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DED1_YEAST | DED1 | genetic | 27708008 | |
DYR_YEAST | DFR1 | genetic | 27708008 | |
SEC65_YEAST | SEC65 | genetic | 27708008 | |
RNA1_YEAST | RNA1 | genetic | 27708008 | |
GPI12_YEAST | GPI12 | genetic | 27708008 | |
XRN2_YEAST | RAT1 | genetic | 27708008 | |
SEC63_YEAST | SEC63 | genetic | 27708008 | |
ATG29_YEAST | ATG29 | genetic | 27708008 | |
COX10_YEAST | COX10 | genetic | 27708008 | |
HSP71_YEAST | SSA1 | physical | 27050457 | |
ACS1_YEAST | ACS1 | physical | 27050457 | |
IDHC_YEAST | IDP2 | physical | 27050457 | |
RL13A_YEAST | RPL13A | physical | 27050457 | |
RL7A_YEAST | RPL7A | physical | 27050457 | |
ABF2_YEAST | ABF2 | physical | 27050457 | |
RTC1_YEAST | RTC1 | physical | 27050457 | |
GTR1_YEAST | GTR1 | physical | 26206314 | |
GTR2_YEAST | GTR2 | physical | 26206314 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-19, AND MASSSPECTROMETRY. |