dbPTM

YJ49_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YJ49_YEAST
UniProt AC	P47126
Protein Name	Uncharacterized protein YJR079W
Gene Name	YJR079W
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	109
Subcellular Localization
Protein Description
Protein Sequence	MKIKIDIIHFINAPPFFFFFVDAEASQLKAFQLFLLGHIFYTYIHTYICDFDEFETKDLAEGKIGDLISRLEFCSNAIIESLPNTFQSFVPVKFSTDKLLEESKGLLDV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YJ49_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YJ49_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YJ49_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YJ49_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRP9_YEAST	PRP9	genetic	27708008
TCPD_YEAST	CCT4	genetic	27708008
MAK21_YEAST	MAK21	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
TIP20_YEAST	TIP20	genetic	27708008
ATC7_YEAST	NEO1	genetic	27708008
PRP19_YEAST	PRP19	genetic	27708008
GPI12_YEAST	GPI12	genetic	27708008
SEC62_YEAST	SEC62	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YJ49_YEAST

Related Literatures of Post-Translational Modification