dbPTM

SPL2_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SPL2_YEAST
UniProt AC	P38839
Protein Name	Putative cyclin-dependent kinase inhibitor SPL2
Gene Name	SPL2
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	148
Subcellular Localization	Cytoplasmic granule . Cytoplasm .
Protein Description	Putative cyclin-dependent kinase (CDK) inhibitor necessary and sufficient for PHO pathway-dependent down-regulation of low-affinity phosphate transport..
Protein Sequence	MGTYTPLIYNIYNVHIWVFTESQGQIGQMSPRGKMETAVSQGQHKQLKDGHQHKGRKLSEEIASLLRLKECRRLNPASYYTPRRTSQSQSLSGSTFKEYNEYINEKDSSRAQRQNAAAVLSKLAHDFWENDCVIDEDIFEDSSDEEQS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
59	Phosphorylation	QHKGRKLSEEIASLL CCCCCHHHHHHHHHH	35.90	17330950
64	Phosphorylation	KLSEEIASLLRLKEC HHHHHHHHHHHHHHH	33.33	28152593
78	Phosphorylation	CRRLNPASYYTPRRT HHHCCCCHHCCCCCC	21.67	19779198
80	Phosphorylation	RLNPASYYTPRRTSQ HCCCCHHCCCCCCCC	14.05	19779198
85	Phosphorylation	SYYTPRRTSQSQSLS HHCCCCCCCCCCCCC	32.19	22890988
86	Phosphorylation	YYTPRRTSQSQSLSG HCCCCCCCCCCCCCC	26.48	17330950
88	Phosphorylation	TPRRTSQSQSLSGST CCCCCCCCCCCCCCC	22.85	22890988
90	Phosphorylation	RRTSQSQSLSGSTFK CCCCCCCCCCCCCHH	29.74	22890988
92	Phosphorylation	TSQSQSLSGSTFKEY CCCCCCCCCCCHHHH	35.62	21082442
106	Ubiquitination	YNEYINEKDSSRAQR HHHHHCHHHCHHHHH	59.42	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SPL2_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SPL2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SPL2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PLC1_YEAST	PLC1	genetic	9475719
GSF2_YEAST	GSF2	genetic	16269340
FDFT_YEAST	ERG9	genetic	16269340
RTC1_YEAST	RTC1	physical	18467557
STX8_YEAST	SYN8	genetic	27708008
YCY0_YEAST	YCR090C	genetic	27708008
TMS1_YEAST	TMS1	genetic	27708008
HRQ1_YEAST	HRQ1	genetic	27708008
CWC21_YEAST	CWC21	genetic	27708008
YAJ9_YEAST	YAR029W	genetic	27708008
RL19A_YEAST	RPL19B	genetic	27708008
RL19B_YEAST	RPL19B	genetic	27708008
TREB_YEAST	NTH2	genetic	27708008
ERV15_YEAST	ERV15	genetic	27708008
HPC2_YEAST	HPC2	genetic	27708008
DHAS_YEAST	HOM2	genetic	27708008
TRM82_YEAST	TRM82	genetic	27708008
UME6_YEAST	UME6	genetic	27708008
YDR22_YEAST	YDR222W	genetic	27708008
PEX5_YEAST	PEX5	genetic	27708008
LCMT1_YEAST	PPM1	genetic	27708008
PP2C2_YEAST	PTC2	genetic	27708008
RAD4_YEAST	RAD4	genetic	27708008
FAR7_YEAST	FAR7	genetic	27708008
YGI1_YEAST	YGL081W	genetic	27708008
ARO8_YEAST	ARO8	genetic	27708008
TNA1_YEAST	TNA1	genetic	27708008
CSN12_YEAST	YJR084W	genetic	27708008
SST2_YEAST	SST2	genetic	27708008
GTR1_YEAST	GTR1	genetic	27708008
IZH2_YEAST	IZH2	genetic	27708008
YOL19_YEAST	YOL019W	genetic	27708008
CY1_YEAST	CYT1	genetic	27708008
ELP3_YEAST	ELP3	genetic	27708008
AP1G1_YEAST	APL4	genetic	27708008
SPEE_YEAST	SPE3	genetic	27708008
MRL1_YEAST	MRL1	genetic	27708008
KAR3_YEAST	KAR3	genetic	27708008
PHO4_YEAST	PHO4	genetic	27618952

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SPL2_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-86, AND MASSSPECTROMETRY.	18407956 [Abstract]
"Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-59 AND SER-86, AND MASSSPECTROMETRY.	17330950 [Abstract]