UniProt ID | ELOB_MOUSE | |
---|---|---|
UniProt AC | P62869 | |
Protein Name | Elongin-B | |
Gene Name | Elob {ECO:0000312|MGI:MGI:1914923} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 118 | |
Subcellular Localization | Nucleus . | |
Protein Description | SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (By similarity). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells. [PubMed: 27863225] | |
Protein Sequence | MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDVFLMIR -------CCEEEEEE | 10.01 | - | |
19 | Ubiquitination | TTIFTDAKESSTVFE EEEECCCCCCCCHHH | 62.02 | - | |
28 | Succinylation | SSTVFELKRIVEGIL CCCHHHHHHHHHHHH | 32.64 | 23954790 | |
36 | Ubiquitination | RIVEGILKRPPEEQR HHHHHHHCCCHHHHH | 62.02 | - | |
46 | Acetylation | PEEQRLYKDDQLLDD HHHHHCCCCCCCCCC | 60.46 | 23806337 | |
46 | Succinylation | PEEQRLYKDDQLLDD HHHHHCCCCCCCCCC | 60.46 | 23954790 | |
60 | S-nitrosocysteine | DGKTLGECGFTSQTA CCCCCCCCCCCCCCC | 5.29 | - | |
60 | S-nitrosylation | DGKTLGECGFTSQTA CCCCCCCCCCCCCCC | 5.29 | 21278135 | |
84 | Phosphorylation | LAFRADDTFEALRIE EEEECCCCCHHEEEC | 24.75 | 25521595 | |
95 | Phosphorylation | LRIEPFSSPPELPDV EEECCCCCCCCCCCC | 44.87 | 25195567 | |
104 | Ubiquitination | PELPDVMKPQDSGGS CCCCCCCCCCCCCCC | 39.10 | - | |
108 | Phosphorylation | DVMKPQDSGGSANEQ CCCCCCCCCCCCHHH | 39.54 | 26643407 | |
111 | Phosphorylation | KPQDSGGSANEQAVQ CCCCCCCCCHHHHCC | 31.29 | 26643407 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ELOB_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ELOB_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ELOB_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ELOB_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...