| UniProt ID | OSR1_HUMAN | |
|---|---|---|
| UniProt AC | Q8TAX0 | |
| Protein Name | Protein odd-skipped-related 1 | |
| Gene Name | OSR1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 266 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription factor that plays a role in the regulation of embryonic heart and urogenital development.. | |
| Protein Sequence | MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKPRFDFANLALAATQEDPAKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIKC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 68 | Phosphorylation | AMHLPRSSFSKVPGT CCCCCHHHHCCCCCC | 34.51 | 24719451 | |
| 75 | Phosphorylation | SFSKVPGTVSSLVDA HHCCCCCCHHHHHHH | 15.90 | 23186163 | |
| 77 | Phosphorylation | SKVPGTVSSLVDARF CCCCCCHHHHHHHHC | 20.14 | 23917254 | |
| 78 | Phosphorylation | KVPGTVSSLVDARFQ CCCCCHHHHHHHHCC | 28.24 | 23917254 | |
| 112 | Acetylation | GGSVPALKTKPRFDF CCCCCCCCCCCCCCH | 57.52 | 24886897 | |
| 116 | Asymmetric dimethylarginine | PALKTKPRFDFANLA CCCCCCCCCCHHHHH | 45.37 | - | |
| 116 | Methylation | PALKTKPRFDFANLA CCCCCCCCCCHHHHH | 45.37 | - | |
| 133 | Ubiquitination | ATQEDPAKLGRGEGP HCCCCHHHCCCCCCC | 57.79 | 22817900 | |
| 142 | Phosphorylation | GRGEGPGSPAGGLGA CCCCCCCCCCCHHHH | 18.08 | 29116813 | |
| 154 | Phosphorylation | LGALLDVTKLSPEKK HHHHHHHHCCCCCCC | 26.40 | 28857561 | |
| 157 | Phosphorylation | LLDVTKLSPEKKPTR HHHHHCCCCCCCCCC | 32.35 | 28348404 | |
| 160 | Acetylation | VTKLSPEKKPTRGRL HHCCCCCCCCCCCCC | 68.39 | 20167786 | |
| 161 | Acetylation | TKLSPEKKPTRGRLP HCCCCCCCCCCCCCC | 50.38 | 20167786 | |
| 169 | Phosphorylation | PTRGRLPSKTKKEFV CCCCCCCCCCCHHHH | 58.51 | 24719451 | |
| 172 | Acetylation | GRLPSKTKKEFVCKF CCCCCCCCHHHHHHH | 54.78 | 20167786 | |
| 203 | Phosphorylation | THTDERPYTCDICHK CCCCCCCCCCHHHHH | 26.65 | 12119563 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OSR1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OSR1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OSR1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VHL_HUMAN | VHL | physical | 16511565 | |
| EGLN1_HUMAN | EGLN1 | physical | 16511565 | |
| VHL_HUMAN | VHL | physical | 15084514 | |
| EGLN1_HUMAN | EGLN1 | physical | 15084514 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
