| UniProt ID | ROA1_HUMAN | |
|---|---|---|
| UniProt AC | P09651 | |
| Protein Name | Heterogeneous nuclear ribonucleoprotein A1 | |
| Gene Name | HNRNPA1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 372 | |
| Subcellular Localization |
Nucleus . Cytoplasm . Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Shuttles continuously between the nucleus and the cytoplasm along with mRNA. Component of ribonucleosomes (PubMed:17289661). Cytoplasm . (Microbial infe |
|
| Protein Description | Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. [PubMed: 17371836 May bind to specific miRNA hairpins] | |
| Protein Sequence | MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MSKSESPK -------CCCCCCCC | 11.68 | 22814378 | |
| 2 | Acetylation | ------MSKSESPKE ------CCCCCCCCC | 44.91 | 14729942 | |
| 2 | Phosphorylation | ------MSKSESPKE ------CCCCCCCCC | 44.91 | 29255136 | |
| 2 (in isoform 2) | Phosphorylation | - | 44.91 | - | |
| 3 | Acetylation | -----MSKSESPKEP -----CCCCCCCCCH | 57.87 | 19608861 | |
| 3 | Malonylation | -----MSKSESPKEP -----CCCCCCCCCH | 57.87 | 26320211 | |
| 3 | Sumoylation | -----MSKSESPKEP -----CCCCCCCCCH | 57.87 | 28112733 | |
| 3 | Ubiquitination | -----MSKSESPKEP -----CCCCCCCCCH | 57.87 | 19608861 | |
| 3 (in isoform 2) | Acetylation | - | 57.87 | - | |
| 4 | Phosphorylation | ----MSKSESPKEPE ----CCCCCCCCCHH | 35.68 | 29255136 | |
| 4 (in isoform 2) | Phosphorylation | - | 35.68 | - | |
| 6 | Phosphorylation | --MSKSESPKEPEQL --CCCCCCCCCHHHH | 48.65 | 29255136 | |
| 6 (in isoform 2) | Phosphorylation | - | 48.65 | - | |
| 8 | Acetylation | MSKSESPKEPEQLRK CCCCCCCCCHHHHHH | 87.79 | 23749302 | |
| 8 | Succinylation | MSKSESPKEPEQLRK CCCCCCCCCHHHHHH | 87.79 | 23954790 | |
| 8 | Sumoylation | MSKSESPKEPEQLRK CCCCCCCCCHHHHHH | 87.79 | 28112733 | |
| 8 | Ubiquitination | MSKSESPKEPEQLRK CCCCCCCCCHHHHHH | 87.79 | - | |
| 8 (in isoform 1) | Ubiquitination | - | 87.79 | 21890473 | |
| 8 (in isoform 2) | Ubiquitination | - | 87.79 | 21890473 | |
| 8 (in isoform 3) | Ubiquitination | - | 87.79 | 21890473 | |
| 14 | Methylation | PKEPEQLRKLFIGGL CCCHHHHHHHHHCCC | 33.07 | 30759947 | |
| 15 | Sumoylation | KEPEQLRKLFIGGLS CCHHHHHHHHHCCCC | 57.23 | - | |
| 15 | Acetylation | KEPEQLRKLFIGGLS CCHHHHHHHHHCCCC | 57.23 | 25825284 | |
| 15 | Sumoylation | KEPEQLRKLFIGGLS CCHHHHHHHHHCCCC | 57.23 | - | |
| 15 | Ubiquitination | KEPEQLRKLFIGGLS CCHHHHHHHHHCCCC | 57.23 | 21890473 | |
| 15 (in isoform 1) | Ubiquitination | - | 57.23 | 21890473 | |
| 15 (in isoform 2) | Ubiquitination | - | 57.23 | 21890473 | |
| 15 (in isoform 3) | Ubiquitination | - | 57.23 | 21890473 | |
| 22 | O-linked_Glycosylation | KLFIGGLSFETTDES HHHHCCCCCCCCCHH | 25.06 | 30059200 | |
| 22 | Phosphorylation | KLFIGGLSFETTDES HHHHCCCCCCCCCHH | 25.06 | 30266825 | |
| 25 | Phosphorylation | IGGLSFETTDESLRS HCCCCCCCCCHHHHH | 37.22 | 30266825 | |
| 26 | Phosphorylation | GGLSFETTDESLRSH CCCCCCCCCHHHHHH | 30.48 | 30266825 | |
| 29 | Phosphorylation | SFETTDESLRSHFEQ CCCCCCHHHHHHHHH | 31.71 | 30266825 | |
| 31 | Methylation | ETTDESLRSHFEQWG CCCCHHHHHHHHHHC | 37.05 | 24390827 | |
| 39 | Phosphorylation | SHFEQWGTLTDCVVM HHHHHHCCEEEEEEE | 24.43 | 28857561 | |
| 41 | Phosphorylation | FEQWGTLTDCVVMRD HHHHCCEEEEEEEEC | 27.47 | 20068231 | |
| 43 | S-nitrosocysteine | QWGTLTDCVVMRDPN HHCCEEEEEEEECCC | 1.78 | - | |
| 43 | S-nitrosylation | QWGTLTDCVVMRDPN HHCCEEEEEEEECCC | 1.78 | 22178444 | |
| 52 | Acetylation | VMRDPNTKRSRGFGF EEECCCCCCCCCCEE | 55.82 | 23954790 | |
| 52 | Ubiquitination | VMRDPNTKRSRGFGF EEECCCCCCCCCCEE | 55.82 | 21906983 | |
| 52 (in isoform 1) | Ubiquitination | - | 55.82 | 21890473 | |
| 52 (in isoform 2) | Ubiquitination | - | 55.82 | 21890473 | |
| 52 (in isoform 3) | Ubiquitination | - | 55.82 | 21890473 | |
| 55 | Methylation | DPNTKRSRGFGFVTY CCCCCCCCCCEEEEE | 48.79 | 81453651 | |
| 61 | Phosphorylation | SRGFGFVTYATVEEV CCCCEEEEEEEHHHH | 12.74 | 28796482 | |
| 62 | Phosphorylation | RGFGFVTYATVEEVD CCCEEEEEEEHHHHH | 8.58 | 28796482 | |
| 64 | Phosphorylation | FGFVTYATVEEVDAA CEEEEEEEHHHHHHH | 20.31 | 28796482 | |
| 72 | Sulfoxidation | VEEVDAAMNARPHKV HHHHHHHHHCCCCCC | 4.28 | 30846556 | |
| 78 | Acetylation | AMNARPHKVDGRVVE HHHCCCCCCCCEECC | 44.71 | 25953088 | |
| 78 | Sumoylation | AMNARPHKVDGRVVE HHHCCCCCCCCEECC | 44.71 | 28112733 | |
| 78 | Ubiquitination | AMNARPHKVDGRVVE HHHCCCCCCCCEECC | 44.71 | - | |
| 78 (in isoform 2) | Ubiquitination | - | 44.71 | - | |
| 87 | Acetylation | DGRVVEPKRAVSRED CCEECCCCCCCCCCC | 39.21 | 30582717 | |
| 87 | Sumoylation | DGRVVEPKRAVSRED CCEECCCCCCCCCCC | 39.21 | - | |
| 87 | Ubiquitination | DGRVVEPKRAVSRED CCEECCCCCCCCCCC | 39.21 | - | |
| 91 | Phosphorylation | VEPKRAVSREDSQRP CCCCCCCCCCCCCCC | 29.03 | 25159151 | |
| 91 (in isoform 2) | Phosphorylation | - | 29.03 | - | |
| 95 | Phosphorylation | RAVSREDSQRPGAHL CCCCCCCCCCCCCEE | 24.28 | 25159151 | |
| 95 (in isoform 2) | Phosphorylation | - | 24.28 | - | |
| 103 | Phosphorylation | QRPGAHLTVKKIFVG CCCCCEEEEEEEEEC | 22.03 | 25159151 | |
| 105 | Acetylation | PGAHLTVKKIFVGGI CCCEEEEEEEEECCC | 34.61 | 23749302 | |
| 105 | Succinylation | PGAHLTVKKIFVGGI CCCEEEEEEEEECCC | 34.61 | 23954790 | |
| 105 | Sumoylation | PGAHLTVKKIFVGGI CCCEEEEEEEEECCC | 34.61 | - | |
| 105 | Ubiquitination | PGAHLTVKKIFVGGI CCCEEEEEEEEECCC | 34.61 | - | |
| 106 | Methylation | GAHLTVKKIFVGGIK CCEEEEEEEEECCCC | 36.72 | 24628741 | |
| 106 | Ubiquitination | GAHLTVKKIFVGGIK CCEEEEEEEEECCCC | 36.72 | - | |
| 113 | Sumoylation | KIFVGGIKEDTEEHH EEEECCCCCCCCHHH | 53.46 | - | |
| 113 | Acetylation | KIFVGGIKEDTEEHH EEEECCCCCCCCHHH | 53.46 | 23954790 | |
| 113 | Sumoylation | KIFVGGIKEDTEEHH EEEECCCCCCCCHHH | 53.46 | 19608861 | |
| 113 | Ubiquitination | KIFVGGIKEDTEEHH EEEECCCCCCCCHHH | 53.46 | 19608861 | |
| 113 (in isoform 2) | Acetylation | - | 53.46 | - | |
| 116 | Phosphorylation | VGGIKEDTEEHHLRD ECCCCCCCCHHHHHH | 44.35 | 20873877 | |
| 122 | Methylation | DTEEHHLRDYFEQYG CCCHHHHHHHHHHHC | 32.02 | - | |
| 124 | Phosphorylation | EEHHLRDYFEQYGKI CHHHHHHHHHHHCCE | 11.55 | 28152594 | |
| 128 | Phosphorylation | LRDYFEQYGKIEVIE HHHHHHHHCCEEEEE | 17.12 | 28152594 | |
| 137 | Sulfoxidation | KIEVIEIMTDRGSGK CEEEEEEEEECCCCC | 1.75 | 21406390 | |
| 138 | Phosphorylation | IEVIEIMTDRGSGKK EEEEEEEEECCCCCC | 28.36 | 21712546 | |
| 138 (in isoform 2) | Phosphorylation | - | 28.36 | - | |
| 140 | Methylation | VIEIMTDRGSGKKRG EEEEEEECCCCCCCE | 31.82 | 30759947 | |
| 142 | Phosphorylation | EIMTDRGSGKKRGFA EEEEECCCCCCCEEE | 48.62 | 25159151 | |
| 142 (in isoform 2) | Phosphorylation | - | 48.62 | - | |
| 144 | Acetylation | MTDRGSGKKRGFAFV EEECCCCCCCEEEEE | 40.78 | 20167786 | |
| 144 | Sumoylation | MTDRGSGKKRGFAFV EEECCCCCCCEEEEE | 40.78 | - | |
| 144 | Ubiquitination | MTDRGSGKKRGFAFV EEECCCCCCCEEEEE | 40.78 | - | |
| 145 | Acetylation | TDRGSGKKRGFAFVT EECCCCCCCEEEEEE | 62.37 | 26051181 | |
| 146 | Methylation | DRGSGKKRGFAFVTF ECCCCCCCEEEEEEC | 49.28 | - | |
| 152 | Phosphorylation | KRGFAFVTFDDHDSV CCEEEEEECCCCCCC | 18.20 | 28857561 | |
| 158 | Phosphorylation | VTFDDHDSVDKIVIQ EECCCCCCCCEEEEE | 28.88 | 20873877 | |
| 161 | Acetylation | DDHDSVDKIVIQKYH CCCCCCCEEEEEEEC | 36.40 | 26051181 | |
| 161 | Methylation | DDHDSVDKIVIQKYH CCCCCCCEEEEEEEC | 36.40 | 23644510 | |
| 161 | Ubiquitination | DDHDSVDKIVIQKYH CCCCCCCEEEEEEEC | 36.40 | - | |
| 166 | Acetylation | VDKIVIQKYHTVNGH CCEEEEEEECCCCCC | 28.07 | 23954790 | |
| 166 | Malonylation | VDKIVIQKYHTVNGH CCEEEEEEECCCCCC | 28.07 | 26320211 | |
| 166 | Ubiquitination | VDKIVIQKYHTVNGH CCEEEEEEECCCCCC | 28.07 | - | |
| 166 (in isoform 2) | Ubiquitination | - | 28.07 | - | |
| 167 | Phosphorylation | DKIVIQKYHTVNGHN CEEEEEEECCCCCCC | 6.07 | 27155012 | |
| 167 (in isoform 2) | Phosphorylation | - | 6.07 | - | |
| 169 | Phosphorylation | IVIQKYHTVNGHNCE EEEEEECCCCCCCHH | 16.75 | 28152594 | |
| 179 | Sumoylation | GHNCEVRKALSKQEM CCCHHHHHHHCHHHH | 59.87 | 28112733 | |
| 182 | Phosphorylation | CEVRKALSKQEMASA HHHHHHHCHHHHHHC | 36.83 | 20860994 | |
| 183 | Sumoylation | EVRKALSKQEMASAS HHHHHHCHHHHHHCC | 51.64 | - | |
| 183 | Sumoylation | EVRKALSKQEMASAS HHHHHHCHHHHHHCC | 51.64 | 28112733 | |
| 183 | Ubiquitination | EVRKALSKQEMASAS HHHHHHCHHHHHHCC | 51.64 | - | |
| 183 (in isoform 2) | Ubiquitination | - | 51.64 | - | |
| 188 | Phosphorylation | LSKQEMASASSSQRG HCHHHHHHCCCCCCC | 27.63 | 20860994 | |
| 190 | Phosphorylation | KQEMASASSSQRGRS HHHHHHCCCCCCCCC | 28.20 | 24702127 | |
| 191 | Phosphorylation | QEMASASSSQRGRSG HHHHHCCCCCCCCCC | 30.15 | 23401153 | |
| 192 | Phosphorylation | EMASASSSQRGRSGS HHHHCCCCCCCCCCC | 22.77 | 16111636 | |
| 194 | Asymmetric dimethylarginine | ASASSSQRGRSGSGN HHCCCCCCCCCCCCC | 44.43 | - | |
| 194 | Methylation | ASASSSQRGRSGSGN HHCCCCCCCCCCCCC | 44.43 | 15782174 | |
| 194 (in isoform 2) | Methylation | - | 44.43 | - | |
| 196 | Dimethylation | ASSSQRGRSGSGNFG CCCCCCCCCCCCCCC | 39.78 | - | |
| 196 | Methylation | ASSSQRGRSGSGNFG CCCCCCCCCCCCCCC | 39.78 | 16288421 | |
| 197 | Phosphorylation | SSSQRGRSGSGNFGG CCCCCCCCCCCCCCC | 39.88 | 22617229 | |
| 197 (in isoform 3) | Phosphorylation | - | 39.88 | 22210691 | |
| 199 | Phosphorylation | SQRGRSGSGNFGGGR CCCCCCCCCCCCCCC | 31.63 | 21454539 | |
| 206 | Asymmetric dimethylarginine | SGNFGGGRGGGFGGN CCCCCCCCCCCCCCC | 43.81 | - | |
| 206 | Methylation | SGNFGGGRGGGFGGN CCCCCCCCCCCCCCC | 43.81 | 24129315 | |
| 206 (in isoform 2) | Methylation | - | 43.81 | - | |
| 217 (in isoform 3) | Phosphorylation | - | 33.31 | 22210691 | |
| 218 | Asymmetric dimethylarginine | GGNDNFGRGGNFSGR CCCCCCCCCCCCCCC | 45.79 | - | |
| 218 | Methylation | GGNDNFGRGGNFSGR CCCCCCCCCCCCCCC | 45.79 | 24129315 | |
| 218 (in isoform 2) | Methylation | - | 45.79 | - | |
| 225 | Asymmetric dimethylarginine | RGGNFSGRGGFGGSR CCCCCCCCCCCCCCC | 40.64 | - | |
| 225 | Methylation | RGGNFSGRGGFGGSR CCCCCCCCCCCCCCC | 40.64 | 24129315 | |
| 225 (in isoform 2) | Dimethylation | - | 40.64 | - | |
| 225 (in isoform 2) | Methylation | - | 40.64 | - | |
| 232 | Asymmetric dimethylarginine | RGGFGGSRGGGGYGG CCCCCCCCCCCCCCC | 51.56 | - | |
| 232 | Methylation | RGGFGGSRGGGGYGG CCCCCCCCCCCCCCC | 51.56 | 24129315 | |
| 232 (in isoform 2) | Dimethylation | - | 51.56 | - | |
| 232 (in isoform 2) | Methylation | - | 51.56 | - | |
| 237 | Phosphorylation | GSRGGGGYGGSGDGY CCCCCCCCCCCCCCC | 22.91 | 22210691 | |
| 240 | Phosphorylation | GGGGYGGSGDGYNGF CCCCCCCCCCCCCCC | 29.37 | 26552605 | |
| 244 | Phosphorylation | YGGSGDGYNGFGNDG CCCCCCCCCCCCCCC | 19.49 | 20090780 | |
| 245 (in isoform 3) | Ubiquitination | - | 44.86 | 21890473 | |
| 253 | Phosphorylation | GFGNDGGYGGGGPGY CCCCCCCCCCCCCCC | 20.37 | 20090780 | |
| 260 | Phosphorylation | YGGGGPGYSGGSRGY CCCCCCCCCCCCCCC | 13.79 | 23186163 | |
| 261 | Phosphorylation | GGGGPGYSGGSRGYG CCCCCCCCCCCCCCC | 42.46 | 23186163 | |
| 264 | Phosphorylation | GPGYSGGSRGYGSGG CCCCCCCCCCCCCCC | 26.51 | 23186163 | |
| 265 | Methylation | PGYSGGSRGYGSGGQ CCCCCCCCCCCCCCC | 45.70 | 115384141 | |
| 277 (in isoform 2) | Ubiquitination | - | 42.96 | - | |
| 285 (in isoform 2) | Phosphorylation | - | 33.24 | - | |
| 286 | Phosphorylation | SGYGGSGSYDSYNNG CCCCCCCCCCCCCCC | 27.71 | 20068231 | |
| 286 (in isoform 2) | Phosphorylation | - | 27.71 | - | |
| 295 (in isoform 2) | Phosphorylation | - | 34.15 | - | |
| 298 (in isoform 2) | Acetylation | - | 10.45 | - | |
| 298 (in isoform 2) | Ubiquitination | - | 10.45 | 21890473 | |
| 305 (in isoform 2) | Phosphorylation | - | 43.01 | - | |
| 308 (in isoform 2) | Phosphorylation | - | 32.90 | - | |
| 309 (in isoform 2) | Phosphorylation | - | 23.42 | - | |
| 310 (in isoform 2) | Phosphorylation | - | 30.17 | - | |
| 311 | Phosphorylation | SNFGGGGSYNDFGNY CCCCCCCCCCCCCCC | 24.84 | 19664995 | |
| 311 (in isoform 2) | Phosphorylation | - | 24.84 | - | |
| 312 | Phosphorylation | NFGGGGSYNDFGNYN CCCCCCCCCCCCCCC | 23.25 | 19702290 | |
| 312 (in isoform 2) | Phosphorylation | - | 23.25 | - | |
| 313 (in isoform 2) | Phosphorylation | - | 39.57 | - | |
| 316 (in isoform 2) | Phosphorylation | - | 38.28 | - | |
| 318 | Phosphorylation | SYNDFGNYNNQSSNF CCCCCCCCCCCCCCC | 18.83 | - | |
| 329 | Acetylation | SSNFGPMKGGNFGGR CCCCCCCCCCCCCCC | 67.79 | 26051181 | |
| 329 | Sumoylation | SSNFGPMKGGNFGGR CCCCCCCCCCCCCCC | 67.79 | - | |
| 329 | Ubiquitination | SSNFGPMKGGNFGGR CCCCCCCCCCCCCCC | 67.79 | - | |
| 336 | Methylation | KGGNFGGRSSGPYGG CCCCCCCCCCCCCCC | 28.20 | 24129315 | |
| 337 | O-linked_Glycosylation | GGNFGGRSSGPYGGG CCCCCCCCCCCCCCC | 42.81 | 30059200 | |
| 337 | Phosphorylation | GGNFGGRSSGPYGGG CCCCCCCCCCCCCCC | 42.81 | 22167270 | |
| 338 | Phosphorylation | GNFGGRSSGPYGGGG CCCCCCCCCCCCCCC | 42.29 | 22167270 | |
| 341 | Phosphorylation | GGRSSGPYGGGGQYF CCCCCCCCCCCCCCC | 31.74 | 21945579 | |
| 347 | Phosphorylation | PYGGGGQYFAKPRNQ CCCCCCCCCCCCCCC | 14.58 | 21945579 | |
| 350 | Sumoylation | GGGQYFAKPRNQGGY CCCCCCCCCCCCCCC | 34.31 | - | |
| 350 | Acetylation | GGGQYFAKPRNQGGY CCCCCCCCCCCCCCC | 34.31 | 19608861 | |
| 350 | Malonylation | GGGQYFAKPRNQGGY CCCCCCCCCCCCCCC | 34.31 | 26320211 | |
| 350 | Methylation | GGGQYFAKPRNQGGY CCCCCCCCCCCCCCC | 34.31 | 68557 | |
| 350 | Sumoylation | GGGQYFAKPRNQGGY CCCCCCCCCCCCCCC | 34.31 | 28112733 | |
| 350 | Ubiquitination | GGGQYFAKPRNQGGY CCCCCCCCCCCCCCC | 34.31 | 20639865 | |
| 350 (in isoform 1) | Ubiquitination | - | 34.31 | 21890473 | |
| 352 | Dimethylation | GQYFAKPRNQGGYGG CCCCCCCCCCCCCCC | 47.61 | - | |
| 352 | Methylation | GQYFAKPRNQGGYGG CCCCCCCCCCCCCCC | 47.61 | 24129315 | |
| 357 | Phosphorylation | KPRNQGGYGGSSSSS CCCCCCCCCCCCCCC | 25.74 | 27273156 | |
| 360 | Phosphorylation | NQGGYGGSSSSSSYG CCCCCCCCCCCCCCC | 23.76 | 23401153 | |
| 361 | O-linked_Glycosylation | QGGYGGSSSSSSYGS CCCCCCCCCCCCCCC | 37.20 | 30059200 | |
| 361 | Phosphorylation | QGGYGGSSSSSSYGS CCCCCCCCCCCCCCC | 37.20 | 25159151 | |
| 362 | O-linked_Glycosylation | GGYGGSSSSSSYGSG CCCCCCCCCCCCCCC | 35.62 | 30059200 | |
| 362 | Phosphorylation | GGYGGSSSSSSYGSG CCCCCCCCCCCCCCC | 35.62 | 25159151 | |
| 363 | O-linked_Glycosylation | GYGGSSSSSSYGSGR CCCCCCCCCCCCCCC | 25.83 | 30059200 | |
| 363 | Phosphorylation | GYGGSSSSSSYGSGR CCCCCCCCCCCCCCC | 25.83 | 25159151 | |
| 364 | O-linked_Glycosylation | YGGSSSSSSYGSGRR CCCCCCCCCCCCCCC | 29.53 | 30059200 | |
| 364 | Phosphorylation | YGGSSSSSSYGSGRR CCCCCCCCCCCCCCC | 29.53 | 25159151 | |
| 365 | O-linked_Glycosylation | GGSSSSSSYGSGRRF CCCCCCCCCCCCCCC | 35.15 | 30059200 | |
| 365 | Phosphorylation | GGSSSSSSYGSGRRF CCCCCCCCCCCCCCC | 35.15 | 25159151 | |
| 366 | Phosphorylation | GSSSSSSYGSGRRF- CCCCCCCCCCCCCC- | 19.77 | 21712546 | |
| 368 | Phosphorylation | SSSSSYGSGRRF--- CCCCCCCCCCCC--- | 22.39 | 20201521 | |
| 370 | Dimethylation | SSSYGSGRRF----- CCCCCCCCCC----- | 38.23 | - | |
| 370 | Methylation | SSSYGSGRRF----- CCCCCCCCCC----- | 38.23 | 24129315 | |
| 371 | Methylation | SSYGSGRRF------ CCCCCCCCC------ | 45.19 | 30759941 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 4 | S | Phosphorylation | Kinase | P70S6KB | Q9UBS0 | PSP |
| 6 | S | Phosphorylation | Kinase | RPS6KB2 | Q9UBS0 | GPS |
| 192 | S | Phosphorylation | Kinase | MKNK1 | Q9BUB5 | GPS |
| 192 | S | Phosphorylation | Kinase | MKNK2 | Q9HBH9 | Uniprot |
| 199 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
| 199 | S | Phosphorylation | Kinase | PKA_GROUP | - | PhosphoELM |
| 199 | S | Phosphorylation | Kinase | PKA-FAMILY | - | GPS |
| 199 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
| 199 | S | Phosphorylation | Kinase | AKT-FAMILY | - | GPS |
| 199 | S | Phosphorylation | Kinase | PRKACA | P00517 | GPS |
| 199 | S | Phosphorylation | Kinase | AKT1 | P31749 | PSP |
| 362 | S | Phosphorylation | Kinase | MKNK1 | Q9BUB5 | GPS |
| 362 | S | Phosphorylation | Kinase | MKNK2 | Q9HBH9 | Uniprot |
| 363 | S | Phosphorylation | Kinase | MKNK2 | Q9HBH9 | Uniprot |
| 363 | S | Phosphorylation | Kinase | MKNK1 | Q9BUB5 | GPS |
| 364 | S | Phosphorylation | Kinase | MKNK2 | Q9HBH9 | Uniprot |
| 364 | S | Phosphorylation | Kinase | MKNK1 | Q9BUB5 | GPS |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 194 | R | Methylation |
| 15782174 |
| 206 | R | Methylation |
| |
| 225 | R | Methylation |
|
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ROA1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 615424 | Inclusion body myopathy with early-onset Paget disease with or without frontotemporal dementia 3 (IBMPFD3) | |||||
| 615426 | Amyotrophic lateral sclerosis 20 (ALS20) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-3; LYS-113 AND LYS-350, ANDMASS SPECTROMETRY. | |
| "Substrate and functional diversity of lysine acetylation revealed bya proteomics survey."; Kim S.C., Sprung R., Chen Y., Xu Y., Ball H., Pei J., Cheng T.,Kho Y., Xiao H., Xiao L., Grishin N.V., White M., Yang X.-J., Zhao Y.; Mol. Cell 23:607-618(2006). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-350, AND MASS SPECTROMETRY. | |
| Methylation | |
| Reference | PubMed |
| "Identifying and quantifying in vivo methylation sites by heavy methylSILAC."; Ong S.E., Mittler G., Mann M.; Nat. Methods 1:119-126(2004). Cited for: METHYLATION [LARGE SCALE ANALYSIS] AT ARG-194; ARG-206 AND ARG-225,AND MASS SPECTROMETRY. | |
| Phosphorylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-357; SER-360; SER-361;SER-362; SER-363; SER-364; SER-365 AND SER-368, AND MASS SPECTROMETRY. | |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6; SER-142 AND SER-368,AND MASS SPECTROMETRY. | |
| "Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle."; Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.; Mol. Cell 31:438-448(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6, AND MASSSPECTROMETRY. | |
| "Combining protein-based IMAC, peptide-based IMAC, and MudPIT forefficient phosphoproteomic analysis."; Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D.,Yates J.R. III; J. Proteome Res. 7:1346-1351(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4, AND MASSSPECTROMETRY. | |
| "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column."; Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.; Anal. Sci. 24:161-166(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6, AND MASSSPECTROMETRY. | |
| "Global proteomic profiling of phosphopeptides using electron transferdissociation tandem mass spectrometry."; Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A.; Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6; SER-91; SER-95;TYR-167 AND SER-338, AND MASS SPECTROMETRY. | |
| "Improved titanium dioxide enrichment of phosphopeptides from HeLacells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra."; Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.; J. Proteome Res. 6:4150-4162(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6, AND MASSSPECTROMETRY. | |
| "Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4 AND SER-6, AND MASSSPECTROMETRY. | |
| "The Mnks are novel components in the control of TNF alphabiosynthesis and phosphorylate and regulate hnRNP A1."; Buxade M., Parra J.L., Rousseau S., Shpiro N., Marquez R., Morrice N.,Bain J., Espel E., Proud C.G.; Immunity 23:177-189(2005). Cited for: PHOSPHORYLATION AT SER-192; SER-362; SER-363 AND SER-364 BY MKNK2. | |
| "Global phosphoproteome analysis on human HepG2 hepatocytes usingreversed-phase diagonal LC."; Gevaert K., Staes A., Van Damme J., De Groot S., Hugelier K.,Demol H., Martens L., Goethals M., Vandekerckhove J.; Proteomics 5:3589-3599(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-138, AND MASSSPECTROMETRY. | |
| "An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells."; Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.; J. Proteome Res. 8:3852-3861(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-341 AND TYR-357, ANDMASS SPECTROMETRY. | |
| "Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer."; Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.; Cell 131:1190-1203(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-347, AND MASSSPECTROMETRY. | |
| "Immunoaffinity profiling of tyrosine phosphorylation in cancercells."; Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.; Nat. Biotechnol. 23:94-101(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-347, AND MASSSPECTROMETRY. | |
| Sumoylation | |
| Reference | PubMed |
| "Sumoylation of heterogeneous nuclear ribonucleoproteins, zinc fingerproteins, and nuclear pore complex proteins: a proteomic analysis."; Li T., Evdokimov E., Shen R.F., Chao C.C., Tekle E., Wang T.,Stadtman E.R., Yang D.C., Chock P.B.; Proc. Natl. Acad. Sci. U.S.A. 101:8551-8556(2004). Cited for: SUMOYLATION AT LYS-113. | |
