UniProt ID | RM13_HUMAN | |
---|---|---|
UniProt AC | Q9BYD1 | |
Protein Name | 39S ribosomal protein L13, mitochondrial | |
Gene Name | MRPL13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 178 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSSFSRAPQ ------CCCCCCCHH | 39.84 | 25944712 | |
77 | Phosphorylation | NKWEQKVYSSHTGYP CHHEEEHHHCCCCCC | 16.11 | 29496907 | |
109 | Phosphorylation | AIVKLAIYGMLPKNL HHHHHHHHCCCCCCH | 7.29 | 29496907 | |
114 | Ubiquitination | AIYGMLPKNLHRRTM HHHCCCCCCHHHHHH | 69.08 | 22817900 | |
120 | Phosphorylation | PKNLHRRTMMERLHL CCCHHHHHHHHHHCC | 22.33 | 22210691 | |
132 | Phosphorylation | LHLFPDEYIPEDILK HCCCCCCCCCHHHHH | 29.20 | - | |
150 | Ubiquitination | EELPQPRKIPKRLDE HHCCCCCCCCCHHHH | 70.78 | 29967540 | |
153 | Ubiquitination | PQPRKIPKRLDEYTQ CCCCCCCCHHHHHCH | 69.90 | 29967540 | |
158 | Phosphorylation | IPKRLDEYTQEEIDA CCCHHHHHCHHHHHC | 17.25 | 30108239 | |
159 | Phosphorylation | PKRLDEYTQEEIDAF CCHHHHHCHHHHHCC | 27.70 | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RT09_HUMAN | MRPS9 | physical | 22939629 | |
RM17_HUMAN | MRPL17 | physical | 22939629 | |
RM16_HUMAN | MRPL16 | physical | 22939629 | |
RM14_HUMAN | MRPL14 | physical | 22939629 | |
RM15_HUMAN | MRPL15 | physical | 22939629 | |
RM42_HUMAN | MRPL42 | physical | 22939629 | |
RM23_HUMAN | MRPL23 | physical | 22939629 | |
RM55_HUMAN | MRPL55 | physical | 22939629 | |
RM39_HUMAN | MRPL39 | physical | 22939629 | |
RT28_HUMAN | MRPS28 | physical | 22939629 | |
RM52_HUMAN | MRPL52 | physical | 22939629 | |
RM24_HUMAN | MRPL24 | physical | 22939629 | |
RM38_HUMAN | MRPL38 | physical | 22939629 | |
RM41_HUMAN | MRPL41 | physical | 22939629 | |
RM19_HUMAN | MRPL19 | physical | 22939629 | |
RM44_HUMAN | MRPL44 | physical | 22939629 | |
SCFD1_HUMAN | SCFD1 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...