UniProt ID | RM52_HUMAN | |
---|---|---|
UniProt AC | Q86TS9 | |
Protein Name | 39S ribosomal protein L52, mitochondrial | |
Gene Name | MRPL52 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 123 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAALGTVLFTGVRRLHCSVAAWAGGQWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MAALGTVLFTGVR --CCCHHHHHHHCCC | 18.19 | - | |
10 | Phosphorylation | ALGTVLFTGVRRLHC CHHHHHHHCCCHHHH | 30.52 | 24719451 | |
61 | Acetylation | GRPAPPMKGQLRRKA CCCCCCCCCHHHHHH | 49.64 | 11792789 | |
68 (in isoform 4) | Phosphorylation | - | 21.19 | - | |
97 | Acetylation | AWQLRQQKLQEEQRK HHHHHHHHHHHHHHH | 43.74 | 25953088 | |
115 | Phosphorylation | ALKPKGASLKSPLPS CCCCCCCCCCCCCCC | 45.02 | 20068231 | |
118 | Phosphorylation | PKGASLKSPLPSQ-- CCCCCCCCCCCCC-- | 36.64 | 27050516 | |
122 | Phosphorylation | SLKSPLPSQ------ CCCCCCCCC------ | 57.09 | 20068231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM52_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM52_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM52_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
RM55_HUMAN | MRPL55 | physical | 22939629 | |
TM177_HUMAN | TMEM177 | physical | 22939629 | |
TSR1_HUMAN | TSR1 | physical | 22939629 | |
RS18_HUMAN | RPS18 | physical | 22939629 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...