dbPTM

RM55_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RM55_HUMAN
UniProt AC	Q7Z7F7
Protein Name	39S ribosomal protein L55, mitochondrial
Gene Name	MRPL55
Organism	Homo sapiens (Human).
Sequence Length	128
Subcellular Localization	Mitochondrion .
Protein Description
Protein Sequence	MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MAAVGSLLGRLRQ --CCHHHHHHHHHHH	17.52	29743597
52	Phosphorylation	RQAYARLYPVLLVKQ HHHHHHHHCEEEEEC	5.92	28152594
83	Phosphorylation	AMPIDLDTLSPEERR EEECCHHHCCHHHHH	36.11	28348404
85	Phosphorylation	PIDLDTLSPEERRAR ECCHHHCCHHHHHHH	32.15	22199227
102	Phosphorylation	KREAQLQSRKEYEQE HHHHHHHCHHHHHHH	54.64	20068231
106	Phosphorylation	QLQSRKEYEQELSDD HHHCHHHHHHHHCHH	26.41	28152594
111	Phosphorylation	KEYEQELSDDLHVER HHHHHHHCHHHHHHH	28.46	26471730
121	Phosphorylation	LHVERYRQFWTRTKK HHHHHHHHHHHHCCC	29.33	27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RM55_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RM55_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RM55_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RT09_HUMAN	MRPS9	physical	22939629
TOM40_HUMAN	TOMM40	physical	22939629
RS23_HUMAN	RPS23	physical	22939629

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RM55_HUMAN

Related Literatures of Post-Translational Modification