UniProt ID | RM55_HUMAN | |
---|---|---|
UniProt AC | Q7Z7F7 | |
Protein Name | 39S ribosomal protein L55, mitochondrial | |
Gene Name | MRPL55 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 128 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MAAVGSLLGRLRQ --CCHHHHHHHHHHH | 17.52 | 29743597 | |
52 | Phosphorylation | RQAYARLYPVLLVKQ HHHHHHHHCEEEEEC | 5.92 | 28152594 | |
83 | Phosphorylation | AMPIDLDTLSPEERR EEECCHHHCCHHHHH | 36.11 | 28348404 | |
85 | Phosphorylation | PIDLDTLSPEERRAR ECCHHHCCHHHHHHH | 32.15 | 22199227 | |
102 | Phosphorylation | KREAQLQSRKEYEQE HHHHHHHCHHHHHHH | 54.64 | 20068231 | |
106 | Phosphorylation | QLQSRKEYEQELSDD HHHCHHHHHHHHCHH | 26.41 | 28152594 | |
111 | Phosphorylation | KEYEQELSDDLHVER HHHHHHHCHHHHHHH | 28.46 | 26471730 | |
121 | Phosphorylation | LHVERYRQFWTRTKK HHHHHHHHHHHHCCC | 29.33 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM55_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM55_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM55_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RT09_HUMAN | MRPS9 | physical | 22939629 | |
TOM40_HUMAN | TOMM40 | physical | 22939629 | |
RS23_HUMAN | RPS23 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...