UniProt ID | RM42_HUMAN | |
---|---|---|
UniProt AC | Q9Y6G3 | |
Protein Name | 39S ribosomal protein L42, mitochondrial {ECO:0000303|PubMed:11551941} | |
Gene Name | MRPL42 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 142 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
73 | Ubiquitination | DIPYEHTKPIPRPDP CCCCCCCCCCCCCCC | 42.74 | 21890473 | |
113 | Phosphorylation | GPMIEQLSKMFFTTK CCHHHHHHHHHHCCC | 23.05 | 20068231 | |
114 | Ubiquitination | PMIEQLSKMFFTTKH CHHHHHHHHHHCCCC | 48.60 | 21890473 | |
120 | Ubiquitination | SKMFFTTKHRWYPHG HHHHHCCCCCCCCCC | 28.28 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM42_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM42_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM42_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...