| UniProt ID | RM42_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y6G3 | |
| Protein Name | 39S ribosomal protein L42, mitochondrial {ECO:0000303|PubMed:11551941} | |
| Gene Name | MRPL42 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 142 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | ||
| Protein Sequence | MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 73 | Ubiquitination | DIPYEHTKPIPRPDP CCCCCCCCCCCCCCC | 42.74 | 21890473 | |
| 113 | Phosphorylation | GPMIEQLSKMFFTTK CCHHHHHHHHHHCCC | 23.05 | 20068231 | |
| 114 | Ubiquitination | PMIEQLSKMFFTTKH CHHHHHHHHHHCCCC | 48.60 | 21890473 | |
| 120 | Ubiquitination | SKMFFTTKHRWYPHG HHHHHCCCCCCCCCC | 28.28 | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM42_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM42_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM42_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...