UniProt ID | RT18A_HUMAN | |
---|---|---|
UniProt AC | Q9NVS2 | |
Protein Name | 39S ribosomal protein S18a, mitochondrial | |
Gene Name | MRPS18A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 196 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAALKALVSGCGRLLRGLLAGPAATSWSRLPARGFREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Ubiquitination | VVETQEGKTTIIEGR EEECCCCCEEEEECE | 41.56 | 24816145 | |
54 | Phosphorylation | TIIEGRITATPKESP EEEECEEEECCCCCC | 24.10 | 27251275 | |
56 | Phosphorylation | IEGRITATPKESPNP EECEEEECCCCCCCC | 26.66 | 27251275 | |
108 | S-palmitoylation | PRKITGLCQEEHRKI CHHHHHHCHHHHHHH | 5.18 | 21044946 | |
114 | Ubiquitination | LCQEEHRKIEECVKM HCHHHHHHHHHHHHH | 57.27 | 24816145 | |
142 | Ubiquitination | LPEGVVPKSKPQLNR CCCCCCCCCCHHHHH | 60.55 | 24816145 | |
150 (in isoform 2) | Phosphorylation | - | 16.02 | 20873877 | |
178 | Phosphorylation | RVRMPVGSPLLRDNV CEECCCCCCCCCCCC | 16.77 | 24719451 | |
216 | Ubiquitination | --------------------------- --------------------------- | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT18A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT18A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT18A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
RM39_HUMAN | MRPL39 | physical | 26186194 | |
RM47_HUMAN | MRPL47 | physical | 26186194 | |
ROA1_HUMAN | HNRNPA1 | physical | 26186194 | |
RT30_HUMAN | MRPS30 | physical | 26186194 | |
RM47_HUMAN | MRPL47 | physical | 28514442 | |
RT30_HUMAN | MRPS30 | physical | 28514442 | |
RM39_HUMAN | MRPL39 | physical | 28514442 | |
RM41_HUMAN | MRPL41 | physical | 28514442 | |
ROA1_HUMAN | HNRNPA1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...