UniProt ID | RT30_HUMAN | |
---|---|---|
UniProt AC | Q9NP92 | |
Protein Name | 39S ribosomal protein S30, mitochondrial | |
Gene Name | MRPS30 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 439 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATVHAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRPKEEKSQLLEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | Phosphorylation | AATPVARYPPIVASM HCCCHHHCCCEEEEE | 12.01 | 29449344 | |
50 | Phosphorylation | RYPPIVASMTADSKA HCCCEEEEECCCCHH | 13.03 | 29449344 | |
52 | Phosphorylation | PPIVASMTADSKAAR CCEEEEECCCCHHHH | 25.47 | 29449344 | |
55 | Phosphorylation | VASMTADSKAARLRR EEEECCCCHHHHHHH | 23.02 | 29449344 | |
56 | Ubiquitination | ASMTADSKAARLRRI EEECCCCHHHHHHHH | 46.76 | 23503661 | |
79 | Ubiquitination | AAESVDEKLRILTKM HHHCHHHHHHHHHHH | 38.30 | 29967540 | |
97 | Phosphorylation | KYMVYPQTFALNADR HHHHCCCCCCCCHHH | 13.33 | 24719451 | |
230 | Methylation | RGRIDDLRYQIDDKP CCCCCCCCEECCCCC | 28.45 | 115483825 | |
236 | Ubiquitination | LRYQIDDKPNNQIRI CCEECCCCCCCEEEE | 45.99 | 24816145 | |
245 | Ubiquitination | NNQIRISKQLAEFVP CCEEEEEHHHHHHCC | 47.13 | 21906983 | |
255 | Phosphorylation | AEFVPLDYSVPIEIP HHHCCCCCCCCCCCC | 21.17 | - | |
265 | Ubiquitination | PIEIPTIKCKPDKLP CCCCCCCCCCCCCCC | 38.39 | 29967540 | |
275 | Methylation | PDKLPLFKRQYENHI CCCCCCCHHHCCCCE | 46.40 | 115973271 | |
287 | Ubiquitination | NHIFVGSKTADPCCY CCEEECCCCCCCCCC | 41.63 | 29967540 | |
398 | Phosphorylation | NICWGTQSKPLYETI CCCCCCCCCCCEEEC | 35.76 | 24719451 | |
399 | Ubiquitination | ICWGTQSKPLYETIE CCCCCCCCCCEEECC | 29.26 | 29967540 | |
430 | Ubiquitination | HFLLNRPKEEKSQLL HHHHCCCHHHHHHHH | 75.23 | 22817900 | |
433 | Ubiquitination | LNRPKEEKSQLLEN- HCCCHHHHHHHHCC- | 44.59 | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT30_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT30_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT30_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...