| UniProt ID | RT30_HUMAN | |
|---|---|---|
| UniProt AC | Q9NP92 | |
| Protein Name | 39S ribosomal protein S30, mitochondrial | |
| Gene Name | MRPS30 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 439 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | ||
| Protein Sequence | MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATVHAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRPKEEKSQLLEN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 44 | Phosphorylation | AATPVARYPPIVASM HCCCHHHCCCEEEEE | 12.01 | 29449344 | |
| 50 | Phosphorylation | RYPPIVASMTADSKA HCCCEEEEECCCCHH | 13.03 | 29449344 | |
| 52 | Phosphorylation | PPIVASMTADSKAAR CCEEEEECCCCHHHH | 25.47 | 29449344 | |
| 55 | Phosphorylation | VASMTADSKAARLRR EEEECCCCHHHHHHH | 23.02 | 29449344 | |
| 56 | Ubiquitination | ASMTADSKAARLRRI EEECCCCHHHHHHHH | 46.76 | 23503661 | |
| 79 | Ubiquitination | AAESVDEKLRILTKM HHHCHHHHHHHHHHH | 38.30 | 29967540 | |
| 97 | Phosphorylation | KYMVYPQTFALNADR HHHHCCCCCCCCHHH | 13.33 | 24719451 | |
| 230 | Methylation | RGRIDDLRYQIDDKP CCCCCCCCEECCCCC | 28.45 | 115483825 | |
| 236 | Ubiquitination | LRYQIDDKPNNQIRI CCEECCCCCCCEEEE | 45.99 | 24816145 | |
| 245 | Ubiquitination | NNQIRISKQLAEFVP CCEEEEEHHHHHHCC | 47.13 | 21906983 | |
| 255 | Phosphorylation | AEFVPLDYSVPIEIP HHHCCCCCCCCCCCC | 21.17 | - | |
| 265 | Ubiquitination | PIEIPTIKCKPDKLP CCCCCCCCCCCCCCC | 38.39 | 29967540 | |
| 275 | Methylation | PDKLPLFKRQYENHI CCCCCCCHHHCCCCE | 46.40 | 115973271 | |
| 287 | Ubiquitination | NHIFVGSKTADPCCY CCEEECCCCCCCCCC | 41.63 | 29967540 | |
| 398 | Phosphorylation | NICWGTQSKPLYETI CCCCCCCCCCCEEEC | 35.76 | 24719451 | |
| 399 | Ubiquitination | ICWGTQSKPLYETIE CCCCCCCCCCEEECC | 29.26 | 29967540 | |
| 430 | Ubiquitination | HFLLNRPKEEKSQLL HHHHCCCHHHHHHHH | 75.23 | 22817900 | |
| 433 | Ubiquitination | LNRPKEEKSQLLEN- HCCCHHHHHHHHCC- | 44.59 | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT30_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT30_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT30_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
