UniProt ID | MASU1_HUMAN | |
---|---|---|
UniProt AC | Q96EH3 | |
Protein Name | Mitochondrial assembly of ribosomal large subunit protein 1 | |
Gene Name | MALSU1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 234 | |
Subcellular Localization | Mitochondrion matrix . Colocalizes with MRPL12 (PubMed:22238375) and/or MRPL14 (PubMed:22829778). | |
Protein Description | May function as a ribosomal silencing factor. Addition to isolated mitochondrial ribosomal subunits partially inhibits translation. Interacts with mitochondrial ribosomal protein L14 (MRPL14), probably blocking formation of intersubunit bridge B8, preventing association of the 28S and 39S ribosomal subunits and the formation of functional ribosomes, thus repressing translation. May also participate in the assembly and/or regulation of the stability of the large subunit of the mitochondrial ribosome.. | |
Protein Sequence | MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
82 | Phosphorylation | VNEGRPESDAADHTG CCCCCCHHHCCCCCC | 34.92 | - | |
97 | Ubiquitination | PKFDIDMMVSLLRQE CCCCHHHHHHHHHHH | 1.32 | 21890473 | |
123 | Phosphorylation | PEMRYTDYFVIVSGT CCCCCCCEEEEEECC | 7.61 | - | |
128 | Phosphorylation | TDYFVIVSGTSTRHL CCEEEEEECCCCHHH | 25.81 | - | |
192 | Ubiquitination | REIYELEKLWTLRSY HHHHHHHHHHCCCCC | 63.05 | 21963094 | |
192 | Ubiquitination | REIYELEKLWTLRSY HHHHHHHHHHCCCCC | 63.05 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MASU1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MASU1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MASU1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SSBP_HUMAN | SSBP1 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...