| UniProt ID | RM30_HUMAN | |
|---|---|---|
| UniProt AC | Q8TCC3 | |
| Protein Name | 39S ribosomal protein L30, mitochondrial | |
| Gene Name | MRPL30 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 161 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | ||
| Protein Sequence | MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 44 | Ubiquitination | TRSRIPEKVFQASPE HHHCCCHHHHHCCHH | 42.89 | 29967540 | |
| 49 | Phosphorylation | PEKVFQASPEDHEKY CHHHHHCCHHHHHHH | 20.31 | 25159151 | |
| 55 | Ubiquitination | ASPEDHEKYGGDPQN CCHHHHHHHCCCCCC | 45.86 | 29967540 | |
| 83 | 2-Hydroxyisobutyrylation | RRRPYWEKDIIKMLG CCCCCHHHHHHHHHC | 39.83 | - | |
| 87 | Ubiquitination | YWEKDIIKMLGLEKA CHHHHHHHHHCCCCC | 28.54 | 21890473 | |
| 87 (in isoform 1) | Ubiquitination | - | 28.54 | 21890473 | |
| 87 (in isoform 3) | Ubiquitination | - | 28.54 | 21890473 | |
| 101 | Ubiquitination | AHTPQVHKNIPSVNA CCCCCCHHCCCCHHH | 58.68 | 29967540 | |
| 105 | Phosphorylation | QVHKNIPSVNAKLKV CCHHCCCCHHHHHHH | 24.98 | 19413330 | |
| 114 | Methylation | NAKLKVVKHLIRIKP HHHHHHHHHHHHCCC | 35.36 | 116253259 | |
| 117 (in isoform 2) | Ubiquitination | - | 4.24 | 21890473 | |
| 152 | Acetylation | LVVQWHLKPVEQKAH EEEEEEEECHHHHHH | 33.84 | 23236377 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM30_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM30_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM30_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RM30_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
