GTPBA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GTPBA_HUMAN
• UniProt AC: A4D1E9
• Protein Name: GTP-binding protein 10
• Gene Name: GTPBP10
• Organism: Homo sapiens (Human).
• Sequence Length: 387
• Subcellular Localization: Nucleus, nucleolus . Chromosome . Found in the dense fibrillar compartment region of the nucleolus. At the onset of mitosis moves to the chromosome surface and remains there until anaphase. Gradually re-assembles into the nucleolus at late anaphase t
• Protein Description: May be involved in the ribosome maturation process. Complements an ObgE(CgtA) function in E.coli ribosome maturation. Plays a role of GTPase in vitro. When missing, disorganization of the nucleolar architecture is observed..
• Protein Sequence: MVHCSCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKDRYPRKRFVAGVGANSKISALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQLLNLWISDTMSSTEPPSKHAVTTSKMDII

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	SCVLFRKYGNFIDKL EEEEEEHHCCHHHHE	17.03	20068231
27	Phosphorylation	RLFTRGGSGGMGYPR EECCCCCCCCCCCCC	34.69	20363803
32	Phosphorylation	GGSGGMGYPRLGGEG CCCCCCCCCCCCCCC	4.01	20363803
75	Phosphorylation	VAGVGANSKISALKG EEECCCCHHHHHHCC	30.72	20068231
78	Phosphorylation	VGANSKISALKGSKG CCCCHHHHHHCCCCC	31.14	20068231
81	Ubiquitination	NSKISALKGSKGKDC CHHHHHHCCCCCCCC	61.94	29967540
111	Ubiquitination	KIIGELNKENDRILV CEEEEECCCCCEEEE	71.20	29967540
184	Succinylation	DYAFTTLKPELGKIM HHHHHCCCHHHHHHC	34.06	23954790
184	Acetylation	DYAFTTLKPELGKIM HHHHHCCCHHHHHHC	34.06	23236377
229 (in isoform 2)	Ubiquitination	-	41.74	21906983
229	Ubiquitination	KHIERTRQLLFVVDI HHHHHHHEEEEEEEC	41.74	22817900
270	Phosphorylation	LYKEELQTKPALLAV HHHHHHCCCCEEEHH	52.17	-
308 (in isoform 1)	Ubiquitination	-	44.47	21906983
308	Ubiquitination	DFLHLFEKNMIPERT HHHHHHHHHCCCCCE	44.47	22817900
365	Phosphorylation	QLLNLWISDTMSSTE HHHHHHHCCCCCCCC	18.56	29052541
367	Phosphorylation	LNLWISDTMSSTEPP HHHHHCCCCCCCCCC	16.50	29052541
369	Phosphorylation	LWISDTMSSTEPPSK HHHCCCCCCCCCCCC	35.88	29052541
370	Phosphorylation	WISDTMSSTEPPSKH HHCCCCCCCCCCCCC	26.43	29052541
371	Phosphorylation	ISDTMSSTEPPSKHA HCCCCCCCCCCCCCC	45.25	29052541
375	Phosphorylation	MSSTEPPSKHAVTTS CCCCCCCCCCCCCCC	48.03	29052541

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GTPBA_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GTPBA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GTPBA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PCBP4_HUMAN	PCBP4	physical	26186194
PCBP4_HUMAN	PCBP4	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.