UniProt ID | RM51_HUMAN | |
---|---|---|
UniProt AC | Q4U2R6 | |
Protein Name | 39S ribosomal protein L51, mitochondrial | |
Gene Name | MRPL51 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 128 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM51_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM51_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM51_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RM52_HUMAN | MRPL52 | physical | 22939629 | |
RM55_HUMAN | MRPL55 | physical | 22939629 | |
RS18_HUMAN | RPS18 | physical | 22939629 | |
TM177_HUMAN | TMEM177 | physical | 22939629 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...