dbPTM

RM51_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RM51_HUMAN
UniProt AC	Q4U2R6
Protein Name	39S ribosomal protein L51, mitochondrial
Gene Name	MRPL51
Organism	Homo sapiens (Human).
Sequence Length	128
Subcellular Localization	Mitochondrion .
Protein Description
Protein Sequence	MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
23	Phosphorylation	WVPLACRSFSLGVPR HHHHHHHHHCCCCCE	21.04	20873877
25	Phosphorylation	PLACRSFSLGVPRLI HHHHHHHCCCCCEEE	26.01	20873877

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RM51_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RM51_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RM51_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RM52_HUMAN	MRPL52	physical	22939629
RM55_HUMAN	MRPL55	physical	22939629
RS18_HUMAN	RPS18	physical	22939629
TM177_HUMAN	TMEM177	physical	22939629

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RM51_HUMAN

Related Literatures of Post-Translational Modification