| UniProt ID | RM28_HUMAN | |
|---|---|---|
| UniProt AC | Q13084 | |
| Protein Name | 39S ribosomal protein L28, mitochondrial | |
| Gene Name | MRPL28 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 256 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | ||
| Protein Sequence | MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Ubiquitination | ---MPLHKYPVWLWK ---CCCCCCCHHHHH | 59.96 | 21890473 | |
| 6 | Phosphorylation | --MPLHKYPVWLWKR --CCCCCCCHHHHHH | 7.71 | - | |
| 12 | Ubiquitination | KYPVWLWKRLQLREG CCCHHHHHHHHHHCC | 40.85 | 21890473 | |
| 22 | Phosphorylation | QLREGICSRLPGHYL HHHCCHHHCCCHHHH | 34.63 | 22210691 | |
| 28 | Phosphorylation | CSRLPGHYLRSLEEE HHCCCHHHHHHHHHC | 15.10 | 27174698 | |
| 31 | Phosphorylation | LPGHYLRSLEEERTP CCHHHHHHHHHCCCC | 37.22 | 27174698 | |
| 37 | Phosphorylation | RSLEEERTPTPVHYR HHHHHCCCCCCCCCC | 34.49 | 28555341 | |
| 39 | Phosphorylation | LEEERTPTPVHYRPH HHHCCCCCCCCCCCC | 37.01 | 22210691 | |
| 43 | Phosphorylation | RTPTPVHYRPHGAKF CCCCCCCCCCCCCCE | 26.52 | 22210691 | |
| 106 | Ubiquitination | KRLKKVWKPQLFERE HHHHHHHCHHHHCHH | 26.35 | 29967540 | |
| 115 | Phosphorylation | QLFEREFYSEILDKK HHHCHHHHHHHHCCC | 10.71 | 20068231 | |
| 139 | Phosphorylation | LDLIDEAYGLDFYIL HHHHHHHHCCCEEEE | 19.04 | 29496907 | |
| 144 | Phosphorylation | EAYGLDFYILKTPKE HHHCCCEEEEECCHH | 12.66 | 29496907 | |
| 150 | Succinylation | FYILKTPKEDLCSKF EEEEECCHHHHHHHH | 69.92 | 23954790 | |
| 150 | 2-Hydroxyisobutyrylation | FYILKTPKEDLCSKF EEEEECCHHHHHHHH | 69.92 | - | |
| 162 | Ubiquitination | SKFGMDLKRGMLLRL HHHCCCCHHHHHHHH | 42.51 | - | |
| 188 | Phosphorylation | PERRAAIYDKYKEFA HHHHHHHHHHHHHHC | 11.14 | 29496907 | |
| 190 | Ubiquitination | RRAAIYDKYKEFAIP HHHHHHHHHHHHCCC | 41.05 | 29967540 | |
| 214 | Ubiquitination | TLEEAIEKQRLLEEK CHHHHHHHHHHHHCC | 34.31 | 29967540 | |
| 221 | 2-Hydroxyisobutyrylation | KQRLLEEKDPVPLFK HHHHHHCCCCCCHHH | 58.94 | - | |
| 221 | Ubiquitination | KQRLLEEKDPVPLFK HHHHHHCCCCCCHHH | 58.94 | 29967540 | |
| 221 | Acetylation | KQRLLEEKDPVPLFK HHHHHHCCCCCCHHH | 58.94 | 26051181 | |
| 251 | Ubiquitination | SEPAVVQKRASGQ-- CCCHHHHHHHCCC-- | 38.02 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM28_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM28_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM28_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...