| UniProt ID | GATC_HUMAN | |
|---|---|---|
| UniProt AC | O43716 | |
| Protein Name | Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03149} | |
| Gene Name | GATC {ECO:0000255|HAMAP-Rule:MF_03149} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 136 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).. | |
| Protein Sequence | MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 59 | Ubiquitination | EAVARLEKAIAFADR HHHHHHHHHHHHHHH | 50.08 | 24816145 | |
| 68 | Methylation | IAFADRLRAVDTDGV HHHHHHHHCCCCCCC | 33.20 | - | |
| 78 | Sulfoxidation | DTDGVEPMESVLEDR CCCCCCCHHHHHHCC | 3.67 | 21406390 | |
| 114 | Phosphorylation | SHRVVEEYFVAPPGN CCHHHHHEEECCCCC | 6.99 | - | |
| 123 | Phosphorylation | VAPPGNISLPKLDEQ ECCCCCCCCCCCCCC | 42.49 | 24719451 | |
| 136 | Phosphorylation | EQEPFPHS------- CCCCCCCC------- | 42.00 | 26471730 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GATC_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GATC_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GATC_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PNPT1_HUMAN | PNPT1 | physical | 22939629 | |
| SYSC_HUMAN | SARS | physical | 22939629 | |
| GATA_HUMAN | QRSL1 | physical | 28514442 | |
| GATB_HUMAN | GATB | physical | 28514442 | |
| HIBCH_HUMAN | HIBCH | physical | 28514442 | |
| PDPR_HUMAN | PDPR | physical | 28514442 | |
| SYNM_HUMAN | NARS2 | physical | 28514442 | |
| D2HDH_HUMAN | D2HGDH | physical | 28514442 | |
| TRUA_HUMAN | PUS1 | physical | 28514442 | |
| DPOG1_HUMAN | POLG | physical | 28514442 | |
| ADRO_HUMAN | FDXR | physical | 28514442 | |
| SSDH_HUMAN | ALDH5A1 | physical | 28514442 | |
| DHTK1_HUMAN | DHTKD1 | physical | 28514442 | |
| NDKM_HUMAN | NME4 | physical | 28514442 | |
| THUM3_HUMAN | THUMPD3 | physical | 28514442 | |
| NPS3A_HUMAN | NIPSNAP3A | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
