| UniProt ID | EWS_HUMAN | |
|---|---|---|
| UniProt AC | Q01844 | |
| Protein Name | RNA-binding protein EWS | |
| Gene Name | EWSR1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 656 | |
| Subcellular Localization | Nucleus . Cytoplasm . Cell membrane . Relocates from cytoplasm to ribosomes upon PTK2B/FAK2 activation. | |
| Protein Description | Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes.. | |
| Protein Sequence | MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 22 | O-linked_Glycosylation | QQGYSAYTAQPTQGY HCCCCEEECCCCCCC | 20.66 | 30059200 | |
| 26 | O-linked_Glycosylation | SAYTAQPTQGYAQTT CEEECCCCCCCCCCC | 23.65 | 30059200 | |
| 32 | O-linked_Glycosylation | PTQGYAQTTQAYGQQ CCCCCCCCCHHCCCC | 16.83 | 30059200 | |
| 33 | O-linked_Glycosylation | TQGYAQTTQAYGQQS CCCCCCCCHHCCCCC | 10.10 | 30059200 | |
| 40 | O-linked_Glycosylation | TQAYGQQSYGTYGQP CHHCCCCCCCCCCCC | 20.03 | 30059200 | |
| 48 | O-linked_Glycosylation | YGTYGQPTDVSYTQA CCCCCCCCCCCCEEC | 40.94 | 30059200 | |
| 51 | O-linked_Glycosylation | YGQPTDVSYTQAQTT CCCCCCCCCEECEEE | 25.85 | 30059200 | |
| 53 | O-linked_Glycosylation | QPTDVSYTQAQTTAT CCCCCCCEECEEEEE | 15.21 | 30059200 | |
| 57 | O-linked_Glycosylation | VSYTQAQTTATYGQT CCCEECEEEEEECCE | 22.78 | 30059200 | |
| 58 | O-linked_Glycosylation | SYTQAQTTATYGQTA CCEECEEEEEECCEE | 12.62 | 30059200 | |
| 60 | O-linked_Glycosylation | TQAQTTATYGQTAYA EECEEEEEECCEEEE | 26.54 | 30059200 | |
| 75 | O-linked_Glycosylation | TSYGQPPTGYTTPTA ECCCCCCCCCCCCCC | 49.88 | 30059200 | |
| 75 | Phosphorylation | TSYGQPPTGYTTPTA ECCCCCCCCCCCCCC | 49.88 | 26074081 | |
| 77 | Phosphorylation | YGQPPTGYTTPTAPQ CCCCCCCCCCCCCCC | 15.21 | 26074081 | |
| 78 | Phosphorylation | GQPPTGYTTPTAPQA CCCCCCCCCCCCCCH | 27.87 | 26074081 | |
| 79 | Phosphorylation | QPPTGYTTPTAPQAY CCCCCCCCCCCCCHH | 15.34 | 19076070 | |
| 81 | Phosphorylation | PTGYTTPTAPQAYSQ CCCCCCCCCCCHHCC | 49.21 | 26074081 | |
| 85 | Ubiquitination | TTPTAPQAYSQPVQG CCCCCCCHHCCCCCC | 12.60 | 22053931 | |
| 87 | O-linked_Glycosylation | PTAPQAYSQPVQGYG CCCCCHHCCCCCCCC | 30.90 | 30059200 | |
| 94 | Ubiquitination | SQPVQGYGTGAYDTT CCCCCCCCCCCCCCC | 25.21 | 21890473 | |
| 95 | O-linked_Glycosylation | QPVQGYGTGAYDTTT CCCCCCCCCCCCCCE | 15.34 | 30059200 | |
| 100 | O-linked_Glycosylation | YGTGAYDTTTATVTT CCCCCCCCCEEEEEE | 17.23 | 30059200 | |
| 100 | Ubiquitination | YGTGAYDTTTATVTT CCCCCCCCCEEEEEE | 17.23 | 23000965 | |
| 101 | O-linked_Glycosylation | GTGAYDTTTATVTTT CCCCCCCCEEEEEEC | 16.13 | 30059200 | |
| 102 | O-linked_Glycosylation | TGAYDTTTATVTTTQ CCCCCCCEEEEEECH | 23.56 | 30059200 | |
| 102 | Ubiquitination | TGAYDTTTATVTTTQ CCCCCCCEEEEEECH | 23.56 | 27667366 | |
| 104 | O-linked_Glycosylation | AYDTTTATVTTTQAS CCCCCEEEEEECHHH | 19.12 | 30059200 | |
| 106 | O-linked_Glycosylation | DTTTATVTTTQASYA CCCEEEEEECHHHHH | 21.55 | 30059200 | |
| 107 | O-linked_Glycosylation | TTTATVTTTQASYAA CCEEEEEECHHHHHH | 16.75 | 30059200 | |
| 108 | O-linked_Glycosylation | TTATVTTTQASYAAQ CEEEEEECHHHHHHH | 16.87 | 30059200 | |
| 111 | O-linked_Glycosylation | TVTTTQASYAAQSAY EEEECHHHHHHHHHH | 12.89 | 30059200 | |
| 134 | O-linked_Glycosylation | YGQQPAATAPTRPQD CCCCCCCCCCCCCCC | 34.96 | 30059200 | |
| 137 | O-linked_Glycosylation | QPAATAPTRPQDGNK CCCCCCCCCCCCCCC | 53.14 | 30059200 | |
| 149 | O-linked_Glycosylation | GNKPTETSQPQSSTG CCCCCCCCCCCCCCC | 33.36 | 30059200 | |
| 153 | O-linked_Glycosylation | TETSQPQSSTGGYNQ CCCCCCCCCCCCCCC | 36.23 | 30059200 | |
| 154 | O-linked_Glycosylation | ETSQPQSSTGGYNQP CCCCCCCCCCCCCCC | 26.31 | 30059200 | |
| 185 | O-linked_Glycosylation | SYPMQPVTAPPSYPP CCCCCCCCCCCCCCC | 39.88 | 30059200 | |
| 189 | O-linked_Glycosylation | QPVTAPPSYPPTSYS CCCCCCCCCCCCCCC | 49.57 | 30059200 | |
| 193 | O-linked_Glycosylation | APPSYPPTSYSSTQP CCCCCCCCCCCCCCC | 35.47 | 30059200 | |
| 194 | O-linked_Glycosylation | PPSYPPTSYSSTQPT CCCCCCCCCCCCCCC | 28.88 | 30059200 | |
| 196 | O-linked_Glycosylation | SYPPTSYSSTQPTSY CCCCCCCCCCCCCCC | 27.03 | 30059200 | |
| 201 | O-linked_Glycosylation | SYSSTQPTSYDQSSY CCCCCCCCCCCCCCC | 30.05 | 30059200 | |
| 207 | O-linked_Glycosylation | PTSYDQSSYSQQNTY CCCCCCCCCCCCCCC | 24.14 | 30059200 | |
| 209 | O-linked_Glycosylation | SYDQSSYSQQNTYGQ CCCCCCCCCCCCCCC | 27.51 | 30059200 | |
| 213 | O-linked_Glycosylation | SSYSQQNTYGQPSSY CCCCCCCCCCCCCCC | 25.37 | 30059200 | |
| 224 | O-linked_Glycosylation | PSSYGQQSSYGQQSS CCCCCCCCCCCCCCC | 20.03 | 30059200 | |
| 225 | O-linked_Glycosylation | SSYGQQSSYGQQSSY CCCCCCCCCCCCCCC | 29.01 | 30059200 | |
| 230 | O-linked_Glycosylation | QSSYGQQSSYGQQPP CCCCCCCCCCCCCCC | 20.03 | 30059200 | |
| 231 | O-linked_Glycosylation | SSYGQQSSYGQQPPT CCCCCCCCCCCCCCC | 29.01 | 30059200 | |
| 238 | O-linked_Glycosylation | SYGQQPPTSYPPQTG CCCCCCCCCCCCCCC | 47.80 | 30059200 | |
| 238 | Phosphorylation | SYGQQPPTSYPPQTG CCCCCCCCCCCCCCC | 47.80 | 19690332 | |
| 239 | O-linked_Glycosylation | YGQQPPTSYPPQTGS CCCCCCCCCCCCCCC | 41.22 | 30059200 | |
| 244 | Methylation | PTSYPPQTGSYSQAP CCCCCCCCCCCCCCC | 33.59 | 11278906 | |
| 244 | O-linked_Glycosylation | PTSYPPQTGSYSQAP CCCCCCCCCCCCCCC | 33.59 | 30059200 | |
| 246 | Methylation | SYPPQTGSYSQAPSQ CCCCCCCCCCCCCCC | 25.62 | 11278906 | |
| 248 | Methylation | PPQTGSYSQAPSQYS CCCCCCCCCCCCCHH | 22.89 | 11278906 | |
| 248 | O-linked_Glycosylation | PPQTGSYSQAPSQYS CCCCCCCCCCCCCHH | 22.89 | 30059200 | |
| 252 | O-linked_Glycosylation | GSYSQAPSQYSQQSS CCCCCCCCCHHCCCC | 44.78 | 30059200 | |
| 253 | Methylation | SYSQAPSQYSQQSSS CCCCCCCCHHCCCCC | 40.62 | 11278906 | |
| 254 | Phosphorylation | YSQAPSQYSQQSSSY CCCCCCCHHCCCCCC | 16.88 | 19690332 | |
| 258 | Methylation | PSQYSQQSSSYGQQS CCCHHCCCCCCCCCC | 17.39 | 11278906 | |
| 259 | Phosphorylation | SQYSQQSSSYGQQSS CCHHCCCCCCCCCCC | 24.20 | 19690332 | |
| 261 | Methylation | YSQQSSSYGQQSSFR HHCCCCCCCCCCCCC | 22.39 | 11278906 | |
| 265 | Methylation | SSSYGQQSSFRQDHP CCCCCCCCCCCCCCC | 24.45 | 11278906 | |
| 265 | Phosphorylation | SSSYGQQSSFRQDHP CCCCCCCCCCCCCCC | 24.45 | 19690332 | |
| 266 | Phosphorylation | SSYGQQSSFRQDHPS CCCCCCCCCCCCCCC | 21.80 | 9341188 | |
| 273 | Phosphorylation | SFRQDHPSSMGVYGQ CCCCCCCCCCCCCCC | 29.54 | 21945579 | |
| 274 | O-linked_Glycosylation | FRQDHPSSMGVYGQE CCCCCCCCCCCCCCC | 24.81 | 30059200 | |
| 274 | Phosphorylation | FRQDHPSSMGVYGQE CCCCCCCCCCCCCCC | 24.81 | 21945579 | |
| 275 | Sulfoxidation | RQDHPSSMGVYGQES CCCCCCCCCCCCCCC | 5.03 | 30846556 | |
| 278 | Phosphorylation | HPSSMGVYGQESGGF CCCCCCCCCCCCCCC | 13.83 | 21945579 | |
| 282 | Phosphorylation | MGVYGQESGGFSGPG CCCCCCCCCCCCCCC | 36.01 | 21945579 | |
| 286 | Phosphorylation | GQESGGFSGPGENRS CCCCCCCCCCCCCCC | 47.56 | 21945579 | |
| 292 | Methylation | FSGPGENRSMSGPDN CCCCCCCCCCCCCCC | 29.45 | - | |
| 300 | Asymmetric dimethylarginine | SMSGPDNRGRGRGGF CCCCCCCCCCCCCCC | 43.49 | - | |
| 300 | Methylation | SMSGPDNRGRGRGGF CCCCCCCCCCCCCCC | 43.49 | 11278906 | |
| 302 | Asymmetric dimethylarginine | SGPDNRGRGRGGFDR CCCCCCCCCCCCCCC | 28.53 | - | |
| 302 | Methylation | SGPDNRGRGRGGFDR CCCCCCCCCCCCCCC | 28.53 | 11278906 | |
| 304 | Asymmetric dimethylarginine | PDNRGRGRGGFDRGG CCCCCCCCCCCCCCC | 40.47 | - | |
| 304 | Methylation | PDNRGRGRGGFDRGG CCCCCCCCCCCCCCC | 40.47 | 11278906 | |
| 305 | Ubiquitination | DNRGRGRGGFDRGGM CCCCCCCCCCCCCCC | 43.90 | 24816145 | |
| 306 | Methylation | NRGRGRGGFDRGGMS CCCCCCCCCCCCCCC | 21.66 | 11278906 | |
| 308 | Methylation | GRGRGGFDRGGMSRG CCCCCCCCCCCCCCC | 52.14 | 11278906 | |
| 309 | Asymmetric dimethylarginine | RGRGGFDRGGMSRGG CCCCCCCCCCCCCCC | 41.10 | - | |
| 309 | Methylation | RGRGGFDRGGMSRGG CCCCCCCCCCCCCCC | 41.10 | 11278906 | |
| 310 | Methylation | GRGGFDRGGMSRGGR CCCCCCCCCCCCCCC | 37.69 | 11278906 | |
| 314 | Asymmetric dimethylarginine | FDRGGMSRGGRGGGR CCCCCCCCCCCCCCC | 42.57 | - | |
| 314 | Methylation | FDRGGMSRGGRGGGR CCCCCCCCCCCCCCC | 42.57 | 11278906 | |
| 315 | Methylation | DRGGMSRGGRGGGRG CCCCCCCCCCCCCCC | 23.89 | 11278906 | |
| 317 | Asymmetric dimethylarginine | GGMSRGGRGGGRGGM CCCCCCCCCCCCCCC | 43.33 | - | |
| 317 | Methylation | GGMSRGGRGGGRGGM CCCCCCCCCCCCCCC | 43.33 | 11278906 | |
| 318 | Ubiquitination | GMSRGGRGGGRGGMG CCCCCCCCCCCCCCC | 46.30 | 24816145 | |
| 320 | Methylation | SRGGRGGGRGGMGSA CCCCCCCCCCCCCCC | 28.08 | 11278906 | |
| 321 | Asymmetric dimethylarginine | RGGRGGGRGGMGSAG CCCCCCCCCCCCCCC | 41.59 | - | |
| 321 | Methylation | RGGRGGGRGGMGSAG CCCCCCCCCCCCCCC | 41.59 | 11278906 | |
| 323 | Methylation | GRGGGRGGMGSAGER CCCCCCCCCCCCCCC | 18.86 | 11278906 | |
| 328 (in isoform 4) | Phosphorylation | - | 27.17 | - | |
| 330 | Dimethylation | GMGSAGERGGFNKPG CCCCCCCCCCCCCCC | 50.01 | - | |
| 330 | Methylation | GMGSAGERGGFNKPG CCCCCCCCCCCCCCC | 50.01 | - | |
| 330 (in isoform 4) | Phosphorylation | - | 50.01 | 22210691 | |
| 351 (in isoform 2) | Ubiquitination | - | 41.15 | 21890473 | |
| 352 | Ubiquitination | DLDLGPPVDPDEDSD CCCCCCCCCCCCCCC | 21.96 | 22053931 | |
| 354 | Ubiquitination | DLGPPVDPDEDSDNS CCCCCCCCCCCCCCC | 47.31 | 33845483 | |
| 355 | Ubiquitination | LGPPVDPDEDSDNSA CCCCCCCCCCCCCCC | 68.80 | 22053931 | |
| 356 | Ubiquitination | GPPVDPDEDSDNSAI CCCCCCCCCCCCCCE | 65.88 | 22053931 | |
| 358 | Phosphorylation | PVDPDEDSDNSAIYV CCCCCCCCCCCCEEE | 36.32 | 20068231 | |
| 360 (in isoform 2) | Ubiquitination | - | 36.97 | 21890473 | |
| 361 | Phosphorylation | PDEDSDNSAIYVQGL CCCCCCCCCEEEECC | 22.49 | 20068231 | |
| 361 | Ubiquitination | PDEDSDNSAIYVQGL CCCCCCCCCEEEECC | 22.49 | 21890473 | |
| 364 | Phosphorylation | DSDNSAIYVQGLNDS CCCCCCEEEECCCCC | 6.09 | 20068231 | |
| 364 | Ubiquitination | DSDNSAIYVQGLNDS CCCCCCEEEECCCCC | 6.09 | 21890473 | |
| 365 | Ubiquitination | SDNSAIYVQGLNDSV CCCCCEEEECCCCCC | 2.73 | 21890473 | |
| 367 | Ubiquitination | NSAIYVQGLNDSVTL CCCEEEECCCCCCCH | 19.19 | 23000965 | |
| 368 | Neddylation | SAIYVQGLNDSVTLD CCEEEECCCCCCCHH | 3.44 | 32015554 | |
| 368 | Ubiquitination | SAIYVQGLNDSVTLD CCEEEECCCCCCCHH | 3.44 | 22053931 | |
| 369 | Ubiquitination | AIYVQGLNDSVTLDD CEEEECCCCCCCHHH | 46.46 | 22053931 | |
| 370 | Ubiquitination | IYVQGLNDSVTLDDL EEEECCCCCCCHHHH | 49.91 | 23000965 | |
| 371 | Phosphorylation | YVQGLNDSVTLDDLA EEECCCCCCCHHHHH | 18.87 | 29496963 | |
| 371 | Ubiquitination | YVQGLNDSVTLDDLA EEECCCCCCCHHHHH | 18.87 | 23000965 | |
| 372 | Ubiquitination | VQGLNDSVTLDDLAD EECCCCCCCHHHHHH | 7.41 | 27667366 | |
| 373 | Phosphorylation | QGLNDSVTLDDLADF ECCCCCCCHHHHHHH | 28.55 | 20068231 | |
| 373 | Ubiquitination | QGLNDSVTLDDLADF ECCCCCCCHHHHHHH | 28.55 | 27667366 | |
| 376 | Ubiquitination | NDSVTLDDLADFFKQ CCCCCHHHHHHHHHH | 47.04 | 21890473 | |
| 377 | Ubiquitination | DSVTLDDLADFFKQC CCCCHHHHHHHHHHC | 5.00 | 21890473 | |
| 377 | Ubiquitination | DSVTLDDLADFFKQC CCCCHHHHHHHHHHC | 5.00 | 21890473 | |
| 377 | Ubiquitination | DSVTLDDLADFFKQC CCCCHHHHHHHHHHC | 5.00 | 21890473 | |
| 378 | Ubiquitination | SVTLDDLADFFKQCG CCCHHHHHHHHHHCC | 20.68 | 21890473 | |
| 382 | Ubiquitination | DDLADFFKQCGVVKM HHHHHHHHHCCCEEE | 44.67 | 23000965 | |
| 383 | Ubiquitination | DLADFFKQCGVVKMN HHHHHHHHCCCEEEC | 24.84 | 23000965 | |
| 384 | Ubiquitination | LADFFKQCGVVKMNK HHHHHHHCCCEEECC | 4.62 | 23000965 | |
| 385 | Ubiquitination | ADFFKQCGVVKMNKR HHHHHHCCCEEECCC | 25.43 | 32142685 | |
| 386 | Ubiquitination | DFFKQCGVVKMNKRT HHHHHCCCEEECCCC | 5.00 | 27667366 | |
| 388 | Acetylation | FKQCGVVKMNKRTGQ HHHCCCEEECCCCCC | 34.06 | 25953088 | |
| 404 | Acetylation | MIHIYLDKETGKPKG EEEEEEECCCCCCCC | 55.36 | 25953088 | |
| 404 | Malonylation | MIHIYLDKETGKPKG EEEEEEECCCCCCCC | 55.36 | 26320211 | |
| 409 | Ubiquitination | LDKETGKPKGDATVS EECCCCCCCCCCEEC | 47.40 | 33845483 | |
| 409 (in isoform 5) | Malonylation | - | 47.40 | 26320211 | |
| 410 | Ubiquitination | DKETGKPKGDATVSY ECCCCCCCCCCEECC | 73.28 | 33845483 | |
| 414 | Phosphorylation | GKPKGDATVSYEDPP CCCCCCCEECCCCCC | 18.09 | 22210691 | |
| 415 | Methylation | KPKGDATVSYEDPPT CCCCCCEECCCCCCC | 6.51 | 11278906 | |
| 415 | Ubiquitination | KPKGDATVSYEDPPT CCCCCCEECCCCCCC | 6.51 | 33845483 | |
| 416 | Phosphorylation | PKGDATVSYEDPPTA CCCCCEECCCCCCCC | 20.60 | 22210691 | |
| 417 | Phosphorylation | KGDATVSYEDPPTAK CCCCEECCCCCCCCC | 21.73 | 28796482 | |
| 422 | Phosphorylation | VSYEDPPTAKAAVEW ECCCCCCCCCEEEEE | 46.29 | 20068231 | |
| 423 | Neddylation | SYEDPPTAKAAVEWF CCCCCCCCCEEEEEE | 12.79 | 32015554 | |
| 423 | Ubiquitination | SYEDPPTAKAAVEWF CCCCCCCCCEEEEEE | 12.79 | 22053931 | |
| 424 | Acetylation | YEDPPTAKAAVEWFD CCCCCCCCEEEEEEC | 39.08 | 26051181 | |
| 424 | Neddylation | YEDPPTAKAAVEWFD CCCCCCCCEEEEEEC | 39.08 | 32015554 | |
| 424 | Ubiquitination | YEDPPTAKAAVEWFD CCCCCCCCEEEEEEC | 39.08 | 21906983 | |
| 424 (in isoform 1) | Ubiquitination | - | 39.08 | 21890473 | |
| 425 | Ubiquitination | EDPPTAKAAVEWFDG CCCCCCCEEEEEECC | 17.80 | 22053931 | |
| 429 | Neddylation | TAKAAVEWFDGKDFQ CCCEEEEEECCCCCC | 7.05 | 32015554 | |
| 429 | Ubiquitination | TAKAAVEWFDGKDFQ CCCEEEEEECCCCCC | 7.05 | 22053931 | |
| 429 (in isoform 5) | Ubiquitination | - | 7.05 | - | |
| 429 | Ubiquitination | TAKAAVEWFDGKDFQ CCCEEEEEECCCCCC | 7.05 | 21890473 | |
| 432 | Ubiquitination | AAVEWFDGKDFQGSK EEEEEECCCCCCCCE | 23.20 | 21890473 | |
| 432 | Ubiquitination | AAVEWFDGKDFQGSK EEEEEECCCCCCCCE | 23.20 | 21890473 | |
| 433 | Acetylation | AVEWFDGKDFQGSKL EEEEECCCCCCCCEE | 58.16 | 23954790 | |
| 433 | Ubiquitination | AVEWFDGKDFQGSKL EEEEECCCCCCCCEE | 58.16 | 23000965 | |
| 433 (in isoform 1) | Ubiquitination | - | 58.16 | 21890473 | |
| 434 | Methylation | VEWFDGKDFQGSKLK EEEECCCCCCCCEEE | 46.78 | 11278906 | |
| 434 | Ubiquitination | VEWFDGKDFQGSKLK EEEECCCCCCCCEEE | 46.78 | 21890473 | |
| 438 | Methylation | DGKDFQGSKLKVSLA CCCCCCCCEEEEECC | 24.83 | 1127890 | |
| 438 | Ubiquitination | DGKDFQGSKLKVSLA CCCCCCCCEEEEECC | 24.83 | 23000965 | |
| 438 (in isoform 5) | Ubiquitination | - | 24.83 | - | |
| 438 | Ubiquitination | DGKDFQGSKLKVSLA CCCCCCCCEEEEECC | 24.83 | 21890473 | |
| 439 | Acetylation | GKDFQGSKLKVSLAR CCCCCCCEEEEECCC | 60.18 | 25825284 | |
| 439 | Ubiquitination | GKDFQGSKLKVSLAR CCCCCCCEEEEECCC | 60.18 | 23000965 | |
| 440 | Ubiquitination | KDFQGSKLKVSLARK CCCCCCEEEEECCCC | 7.68 | 23000965 | |
| 441 | Malonylation | DFQGSKLKVSLARKK CCCCCEEEEECCCCC | 33.25 | 26320211 | |
| 441 | Ubiquitination | DFQGSKLKVSLARKK CCCCCEEEEECCCCC | 33.25 | 32142685 | |
| 442 | Ubiquitination | FQGSKLKVSLARKKP CCCCEEEEECCCCCC | 9.09 | 27667366 | |
| 443 | Phosphorylation | QGSKLKVSLARKKPP CCCEEEEECCCCCCC | 18.09 | 23312004 | |
| 444 | Methylation | GSKLKVSLARKKPPM CCEEEEECCCCCCCC | 6.31 | 11278906 | |
| 444 | Ubiquitination | GSKLKVSLARKKPPM CCEEEEECCCCCCCC | 6.31 | 23000965 | |
| 446 | Ubiquitination | KLKVSLARKKPPMNS EEEEECCCCCCCCCC | 53.47 | 32142685 | |
| 446 (in isoform 5) | Malonylation | - | 53.47 | 26320211 | |
| 447 | Methylation | LKVSLARKKPPMNSM EEEECCCCCCCCCCC | 65.11 | 1127890 | |
| 450 | Methylation | SLARKKPPMNSMRGG ECCCCCCCCCCCCCC | 43.39 | 11278906 | |
| 455 | Asymmetric dimethylarginine | KPPMNSMRGGLPPRE CCCCCCCCCCCCCCC | 35.53 | - | |
| 455 | Methylation | KPPMNSMRGGLPPRE CCCCCCCCCCCCCCC | 35.53 | 11278906 | |
| 461 | Methylation | MRGGLPPREGRGMPP CCCCCCCCCCCCCCC | 58.00 | - | |
| 464 | Asymmetric dimethylarginine | GLPPREGRGMPPPLR CCCCCCCCCCCCCCC | 33.22 | - | |
| 464 | Methylation | GLPPREGRGMPPPLR CCCCCCCCCCCCCCC | 33.22 | 11278906 | |
| 470 | Methylation | GRGMPPPLRGGPGGP CCCCCCCCCCCCCCC | 11.09 | 11278906 | |
| 471 | Asymmetric dimethylarginine | RGMPPPLRGGPGGPG CCCCCCCCCCCCCCC | 54.52 | - | |
| 471 | Methylation | RGMPPPLRGGPGGPG CCCCCCCCCCCCCCC | 54.52 | 24129315 | |
| 476 | Methylation | PLRGGPGGPGGPGGP CCCCCCCCCCCCCCC | 22.32 | 11278906 | |
| 484 | Sulfoxidation | PGGPGGPMGRMGGRG CCCCCCCCCCCCCCC | 6.34 | 21406390 | |
| 486 | Dimethylation | GPGGPMGRMGGRGGD CCCCCCCCCCCCCCC | 17.83 | - | |
| 486 | Methylation | GPGGPMGRMGGRGGD CCCCCCCCCCCCCCC | 17.83 | 24129315 | |
| 489 | Methylation | GPMGRMGGRGGDRGG CCCCCCCCCCCCCCC | 18.73 | 11278906 | |
| 490 | Asymmetric dimethylarginine | PMGRMGGRGGDRGGF CCCCCCCCCCCCCCC | 39.94 | - | |
| 490 | Methylation | PMGRMGGRGGDRGGF CCCCCCCCCCCCCCC | 39.94 | 11278906 | |
| 493 | Methylation | RMGGRGGDRGGFPPR CCCCCCCCCCCCCCC | 49.20 | 1127890 | |
| 494 | Asymmetric dimethylarginine | MGGRGGDRGGFPPRG CCCCCCCCCCCCCCC | 50.86 | - | |
| 494 | Methylation | MGGRGGDRGGFPPRG CCCCCCCCCCCCCCC | 50.86 | 11278906 | |
| 495 | Methylation | GGRGGDRGGFPPRGP CCCCCCCCCCCCCCC | 47.00 | 11278906 | |
| 499 | Methylation | GDRGGFPPRGPRGSR CCCCCCCCCCCCCCC | 52.15 | 11278906 | |
| 500 | Asymmetric dimethylarginine | DRGGFPPRGPRGSRG CCCCCCCCCCCCCCC | 68.90 | - | |
| 500 | Methylation | DRGGFPPRGPRGSRG CCCCCCCCCCCCCCC | 68.90 | 11278906 | |
| 502 | Methylation | GGFPPRGPRGSRGNP CCCCCCCCCCCCCCC | 38.44 | 1127890 | |
| 503 | Asymmetric dimethylarginine | GFPPRGPRGSRGNPS CCCCCCCCCCCCCCC | 59.55 | - | |
| 503 | Methylation | GFPPRGPRGSRGNPS CCCCCCCCCCCCCCC | 59.55 | 11278906 | |
| 505 | Methylation | PPRGPRGSRGNPSGG CCCCCCCCCCCCCCC | 37.99 | 11278906 | |
| 506 | Asymmetric dimethylarginine | PRGPRGSRGNPSGGG CCCCCCCCCCCCCCC | 52.29 | - | |
| 506 | Methylation | PRGPRGSRGNPSGGG CCCCCCCCCCCCCCC | 52.29 | 11278906 | |
| 507 | Methylation | RGPRGSRGNPSGGGN CCCCCCCCCCCCCCC | 52.69 | 11278906 | |
| 508 | Methylation | GPRGSRGNPSGGGNV CCCCCCCCCCCCCCC | 26.84 | 1127890 | |
| 509 | Methylation | PRGSRGNPSGGGNVQ CCCCCCCCCCCCCCC | 36.86 | 11278906 | |
| 510 | Phosphorylation | RGSRGNPSGGGNVQH CCCCCCCCCCCCCCC | 54.81 | 29507054 | |
| 511 | Methylation | GSRGNPSGGGNVQHR CCCCCCCCCCCCCCC | 49.65 | 11278906 | |
| 516 | Methylation | PSGGGNVQHRAGDWQ CCCCCCCCCCCCCCC | 25.09 | 11278906 | |
| 519 | Methylation | GGNVQHRAGDWQCPN CCCCCCCCCCCCCCC | 20.40 | 11278906 | |
| 525 | Methylation | RAGDWQCPNPGCGNQ CCCCCCCCCCCCCCC | 34.64 | 11278906 | |
| 533 | Methylation | NPGCGNQNFAWRTEC CCCCCCCCCEEECCC | 32.38 | 11278906 | |
| 536 | Methylation | CGNQNFAWRTECNQC CCCCCCEEECCCCCC | 12.00 | 11278906 | |
| 540 | Methylation | NFAWRTECNQCKAPK CCEEECCCCCCCCCC | 4.16 | 11278906 | |
| 544 | Methylation | RTECNQCKAPKPEGF ECCCCCCCCCCCCCC | 58.94 | 11278906 | |
| 546 | Ubiquitination | ECNQCKAPKPEGFLP CCCCCCCCCCCCCCC | 37.92 | 24816145 | |
| 547 | Methylation | CNQCKAPKPEGFLPP CCCCCCCCCCCCCCC | 61.64 | 11278906 | |
| 551 | Methylation | KAPKPEGFLPPPFPP CCCCCCCCCCCCCCC | 9.86 | 11278906 | |
| 559 | Methylation | LPPPFPPPGGDRGRG CCCCCCCCCCCCCCC | 60.69 | 11278906 | |
| 562 | Methylation | PFPPPGGDRGRGGPG CCCCCCCCCCCCCCC | 56.63 | 11278906 | |
| 563 | Asymmetric dimethylarginine | FPPPGGDRGRGGPGG CCCCCCCCCCCCCCC | 39.73 | - | |
| 563 | Methylation | FPPPGGDRGRGGPGG CCCCCCCCCCCCCCC | 39.73 | 11278906 | |
| 564 | Methylation | PPPGGDRGRGGPGGM CCCCCCCCCCCCCCC | 37.01 | 11278906 | |
| 565 | Asymmetric dimethylarginine | PPGGDRGRGGPGGMR CCCCCCCCCCCCCCC | 48.03 | - | |
| 565 | Methylation | PPGGDRGRGGPGGMR CCCCCCCCCCCCCCC | 48.03 | 11278906 | |
| 568 | Methylation | GDRGRGGPGGMRGGR CCCCCCCCCCCCCCC | 38.70 | 11278906 | |
| 570 | Methylation | RGRGGPGGMRGGRGG CCCCCCCCCCCCCCC | 13.02 | 11278906 | |
| 570 | Ubiquitination | RGRGGPGGMRGGRGG CCCCCCCCCCCCCCC | 13.02 | 24816145 | |
| 571 | Methylation | GRGGPGGMRGGRGGL CCCCCCCCCCCCCCC | 4.45 | 11278906 | |
| 572 | Asymmetric dimethylarginine | RGGPGGMRGGRGGLM CCCCCCCCCCCCCCC | 47.92 | - | |
| 572 | Methylation | RGGPGGMRGGRGGLM CCCCCCCCCCCCCCC | 47.92 | 11278906 | |
| 574 | Methylation | GPGGMRGGRGGLMDR CCCCCCCCCCCCCCC | 18.07 | 11278906 | |
| 575 | Asymmetric dimethylarginine | PGGMRGGRGGLMDRG CCCCCCCCCCCCCCC | 38.54 | - | |
| 575 | Methylation | PGGMRGGRGGLMDRG CCCCCCCCCCCCCCC | 38.54 | 11278906 | |
| 575 | Ubiquitination | PGGMRGGRGGLMDRG CCCCCCCCCCCCCCC | 38.54 | 24816145 | |
| 577 | Methylation | GMRGGRGGLMDRGGP CCCCCCCCCCCCCCC | 19.23 | 11278906 | |
| 580 | Methylation | GGRGGLMDRGGPGGM CCCCCCCCCCCCCCC | 51.63 | 11278906 | |
| 581 | Asymmetric dimethylarginine | GRGGLMDRGGPGGMF CCCCCCCCCCCCCCC | 37.69 | - | |
| 581 | Methylation | GRGGLMDRGGPGGMF CCCCCCCCCCCCCCC | 37.69 | 11278906 | |
| 585 | Ubiquitination | LMDRGGPGGMFRGGR CCCCCCCCCCCCCCC | 43.40 | 24816145 | |
| 586 | Methylation | MDRGGPGGMFRGGRG CCCCCCCCCCCCCCC | 18.39 | 11278906 | |
| 587 | Ubiquitination | DRGGPGGMFRGGRGG CCCCCCCCCCCCCCC | 2.28 | 24816145 | |
| 588 | Methylation | RGGPGGMFRGGRGGD CCCCCCCCCCCCCCC | 8.10 | 11278906 | |
| 588 | Ubiquitination | RGGPGGMFRGGRGGD CCCCCCCCCCCCCCC | 8.10 | 24816145 | |
| 589 | Asymmetric dimethylarginine | GGPGGMFRGGRGGDR CCCCCCCCCCCCCCC | 37.45 | - | |
| 589 | Methylation | GGPGGMFRGGRGGDR CCCCCCCCCCCCCCC | 37.45 | 11278906 | |
| 589 | Ubiquitination | GGPGGMFRGGRGGDR CCCCCCCCCCCCCCC | 37.45 | 24816145 | |
| 591 | Methylation | PGGMFRGGRGGDRGG CCCCCCCCCCCCCCC | 22.32 | 11278906 | |
| 592 | Asymmetric dimethylarginine | GGMFRGGRGGDRGGF CCCCCCCCCCCCCCC | 49.06 | - | |
| 592 | Methylation | GGMFRGGRGGDRGGF CCCCCCCCCCCCCCC | 49.06 | 11278906 | |
| 594 | Methylation | MFRGGRGGDRGGFRG CCCCCCCCCCCCCCC | 21.78 | 11278906 | |
| 595 | Methylation | FRGGRGGDRGGFRGG CCCCCCCCCCCCCCC | 49.20 | 11278906 | |
| 596 | Asymmetric dimethylarginine | RGGRGGDRGGFRGGR CCCCCCCCCCCCCCC | 50.86 | - | |
| 596 | Methylation | RGGRGGDRGGFRGGR CCCCCCCCCCCCCCC | 50.86 | 11278906 | |
| 597 | Methylation | GGRGGDRGGFRGGRG CCCCCCCCCCCCCCC | 44.31 | 11278906 | |
| 599 | Methylation | RGGDRGGFRGGRGMD CCCCCCCCCCCCCCC | 7.95 | 11278906 | |
| 599 | Ubiquitination | RGGDRGGFRGGRGMD CCCCCCCCCCCCCCC | 7.95 | 24816145 | |
| 600 | Asymmetric dimethylarginine | GGDRGGFRGGRGMDR CCCCCCCCCCCCCCC | 50.35 | - | |
| 600 | Methylation | GGDRGGFRGGRGMDR CCCCCCCCCCCCCCC | 50.35 | 11278906 | |
| 600 | Ubiquitination | GGDRGGFRGGRGMDR CCCCCCCCCCCCCCC | 50.35 | 24816145 | |
| 601 | Methylation | GDRGGFRGGRGMDRG CCCCCCCCCCCCCCC | 28.08 | 11278906 | |
| 601 | Ubiquitination | GDRGGFRGGRGMDRG CCCCCCCCCCCCCCC | 28.08 | 24816145 | |
| 602 | Methylation | DRGGFRGGRGMDRGG CCCCCCCCCCCCCCC | 20.79 | 11278906 | |
| 602 | Ubiquitination | DRGGFRGGRGMDRGG CCCCCCCCCCCCCCC | 20.79 | 24816145 | |
| 603 | Asymmetric dimethylarginine | RGGFRGGRGMDRGGF CCCCCCCCCCCCCCC | 39.84 | - | |
| 603 | Methylation | RGGFRGGRGMDRGGF CCCCCCCCCCCCCCC | 39.84 | 11278906 | |
| 603 | Ubiquitination | RGGFRGGRGMDRGGF CCCCCCCCCCCCCCC | 39.84 | 24816145 | |
| 604 | Ubiquitination | GGFRGGRGMDRGGFG CCCCCCCCCCCCCCC | 26.14 | 24816145 | |
| 605 | Methylation | GFRGGRGMDRGGFGG CCCCCCCCCCCCCCC | 2.82 | 11278906 | |
| 606 | Methylation | FRGGRGMDRGGFGGG CCCCCCCCCCCCCCC | 49.23 | 11278906 | |
| 607 | Asymmetric dimethylarginine | RGGRGMDRGGFGGGR CCCCCCCCCCCCCCC | 37.94 | - | |
| 607 | Methylation | RGGRGMDRGGFGGGR CCCCCCCCCCCCCCC | 37.94 | 11278906 | |
| 608 | Methylation | GGRGMDRGGFGGGRR CCCCCCCCCCCCCCC | 31.36 | 11278906 | |
| 612 | Methylation | MDRGGFGGGRRGGPG CCCCCCCCCCCCCCC | 24.95 | 11278906 | |
| 614 | Dimethylation | RGGFGGGRRGGPGGP CCCCCCCCCCCCCCC | 37.03 | - | |
| 614 | Methylation | RGGFGGGRRGGPGGP CCCCCCCCCCCCCCC | 37.03 | 11278906 | |
| 615 | Asymmetric dimethylarginine | GGFGGGRRGGPGGPP CCCCCCCCCCCCCCC | 58.66 | - | |
| 615 | Methylation | GGFGGGRRGGPGGPP CCCCCCCCCCCCCCC | 58.66 | 24129315 | |
| 617 | Ubiquitination | FGGGRRGGPGGPPGP CCCCCCCCCCCCCCH | 18.83 | 24816145 | |
| 620 | Methylation | GRRGGPGGPPGPLME CCCCCCCCCCCHHHH | 28.50 | 11278906 | |
| 626 | Ubiquitination | GGPPGPLMEQMGGRR CCCCCHHHHHCCCCC | 3.65 | 24816145 | |
| 628 | Ubiquitination | PPGPLMEQMGGRRGG CCCHHHHHCCCCCCC | 23.12 | 24816145 | |
| 632 | Dimethylation | LMEQMGGRRGGRGGP HHHHCCCCCCCCCCC | 28.48 | - | |
| 632 | Methylation | LMEQMGGRRGGRGGP HHHHCCCCCCCCCCC | 28.48 | - | |
| 633 | Asymmetric dimethylarginine | MEQMGGRRGGRGGPG HHHCCCCCCCCCCCC | 56.01 | - | |
| 633 | Methylation | MEQMGGRRGGRGGPG HHHCCCCCCCCCCCC | 56.01 | 11278906 | |
| 635 | Methylation | QMGGRRGGRGGPGKM HCCCCCCCCCCCCCC | 24.21 | 11278906 | |
| 636 | Asymmetric dimethylarginine | MGGRRGGRGGPGKMD CCCCCCCCCCCCCCC | 50.12 | - | |
| 636 | Methylation | MGGRRGGRGGPGKMD CCCCCCCCCCCCCCC | 50.12 | 11278906 | |
| 638 | Methylation | GRRGGRGGPGKMDKG CCCCCCCCCCCCCCC | 26.82 | 11278906 | |
| 639 | Ubiquitination | RRGGRGGPGKMDKGE CCCCCCCCCCCCCCC | 41.89 | 24816145 | |
| 640 | Ubiquitination | RGGRGGPGKMDKGEH CCCCCCCCCCCCCCH | 40.99 | 24816145 | |
| 641 | Acetylation | GGRGGPGKMDKGEHR CCCCCCCCCCCCCHH | 47.24 | 25953088 | |
| 641 | Methylation | GGRGGPGKMDKGEHR CCCCCCCCCCCCCHH | 47.24 | 11278906 | |
| 641 | Ubiquitination | GGRGGPGKMDKGEHR CCCCCCCCCCCCCHH | 47.24 | 24816145 | |
| 643 | Ubiquitination | RGGPGKMDKGEHRQE CCCCCCCCCCCHHHH | 60.33 | 24816145 | |
| 644 | Ubiquitination | GGPGKMDKGEHRQER CCCCCCCCCCHHHHH | 63.80 | 24816145 | |
| 645 | Ubiquitination | GPGKMDKGEHRQERR CCCCCCCCCHHHHHC | 31.51 | 24816145 | |
| 649 | Ubiquitination | MDKGEHRQERRDRPY CCCCCHHHHHCCCCC | 50.91 | 24816145 | |
| 656 | Phosphorylation | QERRDRPY------- HHHCCCCC------- | 31.89 | 21647358 | |
| 656 | Ubiquitination | QERRDRPY------- HHHCCCCC------- | 31.89 | 24816145 | |
| 657 | Ubiquitination | ERRDRPY-------- HHCCCCC-------- | 24816145 | ||
| 658 | Ubiquitination | RRDRPY--------- HCCCCC--------- | 24816145 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 79 | T | Phosphorylation | Kinase | ATM | Q13315 | PSP |
| 79 | T | Phosphorylation | Kinase | ATR | Q13535 | PSP |
| 79 | T | Phosphorylation | Kinase | MAPK1 | P28482 | GPS |
| 79 | T | Phosphorylation | Kinase | MAPK3 | P27361 | GPS |
| 79 | T | Phosphorylation | Kinase | MAPK8 | P45983-2 | GPS |
| 79 | T | Phosphorylation | Kinase | MAPK11 | Q15759 | GPS |
| 79 | T | Phosphorylation | Kinase | MAPK14 | Q16539 | GPS |
| 266 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
| 266 | S | Phosphorylation | Kinase | PKC-FAMILY | - | GPS |
| 266 | S | Phosphorylation | Kinase | PKC | - | Uniprot |
| 266 | S | Phosphorylation | Kinase | PKC_GROUP | - | PhosphoELM |
| 278 | Y | Phosphorylation | Kinase | SRC | P12931 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 266 | S | Phosphorylation |
| 9341188 |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EWS_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| H00035 | Ewing's sarcoma | |||||
| H00049 | Myxoid liposarcoma | |||||
| H00052 | Clear cell sarcoma of soft tissue | |||||
| H00053 | Extraskeletal myxoid chondrosarcoma | |||||
| OMIM Disease | ||||||
| 612219 | Ewing sarcoma (ES) | |||||
| Note=A chromosomal aberration involving EWSR1 is associated with desmoplastic small round cell tumor (DSRCT). Translocation t(11 | ||||||
| 22)(p13 | ||||||
| q12) with WT1. | ||||||
| 612160 | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Methylation | |
| Reference | PubMed |
| "Identification of proteins interacting with protein argininemethyltransferase 8: the Ewing sarcoma (EWS) protein binds independentof its methylation state."; Pahlich S., Zakaryan R.P., Gehring H.; Proteins 72:1125-1137(2008). Cited for: METHYLATION AT ARG-490; ARG-572; ARG-596; ARG-603 AND ARG-607. | |
| "Identifying and quantifying in vivo methylation sites by heavy methylSILAC."; Ong S.E., Mittler G., Mann M.; Nat. Methods 1:119-126(2004). Cited for: METHYLATION [LARGE SCALE ANALYSIS] AT ARG-471; ARG-503; ARG-506;ARG-615; ARG-633 AND ARG-636, AND MASS SPECTROMETRY. | |
| "Exposure on cell surface and extensive arginine methylation of Ewingsarcoma (EWS) protein."; Belyanskaya L.L., Gehrig P.M., Gehring H.; J. Biol. Chem. 276:18681-18687(2001). Cited for: PROTEIN SEQUENCE OF 128-158; 233-247; 268-324; 334-364; 393-439;447-518 AND 551-641, METHYLATION AT ARGININES, AND MASS SPECTROMETRY. | |
