| UniProt ID | NTNG2_HUMAN | |
|---|---|---|
| UniProt AC | Q96CW9 | |
| Protein Name | Netrin-G2 | |
| Gene Name | NTNG2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 530 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor Extracellular side . |
|
| Protein Description | Involved in controlling patterning and neuronal circuit formation at the laminar, cellular, subcellular and synaptic levels. Promotes neurite outgrowth of both axons and dendrites.. | |
| Protein Sequence | MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACATAGSFGNCECYGHSNRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDRCNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRGYTGVRCEQPRCDPADDDGGLDCDRAPGAAPRPATLLGCLLLLGLAARLGR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 122 | N-linked_Glycosylation | YPSPLEANITLSWNK CCCCCEEEEEEEECC | 20.57 | 22041449 | |
| 128 | N-linked_Glycosylation | ANITLSWNKTVELTD EEEEEEECCEEEECC | 27.09 | 22041449 | |
| 248 | Phosphorylation | KGLKEFFTLTDLRMR CCHHHHHHHHHHHHH | 33.78 | 26437602 | |
| 310 | N-linked_Glycosylation | LQCECEHNTTGPDCG EEEEEECCCCCCCCC | 19.62 | UniProtKB CARBOHYD | |
| 332 | Phosphorylation | TRSWRAGSYLPLPHG CCCEECCCCCCCCCC | 23.63 | 19690332 | |
| 333 | Phosphorylation | RSWRAGSYLPLPHGS CCEECCCCCCCCCCC | 16.06 | 19690332 | |
| 340 | Phosphorylation | YLPLPHGSPNACATA CCCCCCCCCCCCCCC | 16.37 | 19690332 | |
| 395 | N-linked_Glycosylation | CRLGYYRNGSAELDD CCCCCCCCCCCCCCC | 32.42 | UniProtKB CARBOHYD | |
| 422 | N-linked_Glycosylation | GSVHDRCNETGFCEC CCCCHHHCCCCCEEE | 51.24 | UniProtKB CARBOHYD | |
| 507 | GPI-anchor | LDCDRAPGAAPRPAT CCCCCCCCCCCCHHH | 33.13 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NTNG2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NTNG2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NTNG2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NTNG2_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...