UniProt ID | COPRS_HUMAN | |
---|---|---|
UniProt AC | Q9NQ92 | |
Protein Name | Coordinator of PRMT5 and differentiation stimulator | |
Gene Name | COPRS | |
Organism | Homo sapiens (Human). | |
Sequence Length | 184 | |
Subcellular Localization | Nucleus . | |
Protein Description | Histone-binding protein required for histone H4 methyltransferase activity of PRMT5. Specifically required for histone H4 'Arg-3' methylation mediated by PRMT5, but not histone H3 'Arg-8' methylation, suggesting that it modulates the substrate specificity of PRMT5. Specifically interacts with the N-terminus of histone H4 but not with histone H3, suggesting that it acts by promoting the association between histone H4 and PRMT5. Involved in CCNE1 promoter repression. Plays a role in muscle cell differentiation by modulating the recruitment of PRMT5 to the promoter of genes involved in the coordination between cell cycle exit and muscle differentiation (By similarity).. | |
Protein Sequence | MDLQAAGAQAQGAAEPSRGPPLPSARGAPPSPEAGFATADHSSQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKEQPGDLFNEDWDSELKADQGNPYDADDIQESISQELKPWVCCAPQGDMIYDPSWHHPPPLIPYYSKMVFETGQFDDAED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDLQAAGA -------CCHHHHHH | 22814378 | ||
17 | Phosphorylation | AQGAAEPSRGPPLPS HCCCCCCCCCCCCCC | 26074081 | ||
18 | Methylation | QGAAEPSRGPPLPSA CCCCCCCCCCCCCCC | - | ||
24 | Phosphorylation | SRGPPLPSARGAPPS CCCCCCCCCCCCCCC | 26074081 | ||
26 | Methylation | GPPLPSARGAPPSPE CCCCCCCCCCCCCCC | - | ||
31 | Phosphorylation | SARGAPPSPEAGFAT CCCCCCCCCCCCCCC | 28176443 | ||
38 | Phosphorylation | SPEAGFATADHSSQE CCCCCCCCCCCCHHH | 26074081 | ||
42 | Phosphorylation | GFATADHSSQERETE CCCCCCCCHHHHHHH | 28176443 | ||
43 | Phosphorylation | FATADHSSQERETEK CCCCCCCHHHHHHHH | 26074081 | ||
48 | Phosphorylation | HSSQERETEKAMDRL CCHHHHHHHHHHHHH | 26074081 | ||
57 | Methylation | KAMDRLARGTQSIPN HHHHHHHHCCCCCCC | - | ||
59 | Phosphorylation | MDRLARGTQSIPNDS HHHHHHCCCCCCCCC | 29255136 | ||
61 | Phosphorylation | RLARGTQSIPNDSPA HHHHCCCCCCCCCCC | 29255136 | ||
66 | Phosphorylation | TQSIPNDSPARGEGT CCCCCCCCCCCCCCC | 29255136 | ||
73 | Phosphorylation | SPARGEGTHSEEEGF CCCCCCCCCCCCCCC | 26074081 | ||
75 | Phosphorylation | ARGEGTHSEEEGFAM CCCCCCCCCCCCCCC | 30576142 | ||
87 | Phosphorylation | FAMDEEDSDGELNTW CCCCCCCCCCCEEEE | 30576142 | ||
93 | Phosphorylation | DSDGELNTWELSEGT CCCCCEEEEEECCCC | 30576142 | ||
97 | Phosphorylation | ELNTWELSEGTNCPP CEEEEEECCCCCCCC | 30576142 | ||
100 | Phosphorylation | TWELSEGTNCPPKEQ EEEECCCCCCCCCCC | 30576142 | ||
128 | Phosphorylation | KADQGNPYDADDIQE CCCCCCCCCHHHHHH | - | ||
138 | Phosphorylation | DDIQESISQELKPWV HHHHHHHHHHHCCCE | 25159151 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COPRS_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COPRS_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COPRS_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RUNX1_HUMAN | RUNX1 | physical | 22193545 | |
ANM5_HUMAN | PRMT5 | physical | 22193545 | |
PEBB_HUMAN | CBFB | physical | 22193545 | |
ANM5_HUMAN | PRMT5 | physical | 18404153 | |
H31T_HUMAN | HIST3H3 | physical | 18404153 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...