UniProt ID | TYB4Y_HUMAN | |
---|---|---|
UniProt AC | O14604 | |
Protein Name | Thymosin beta-4, Y-chromosomal | |
Gene Name | TMSB4Y | |
Organism | Homo sapiens (Human). | |
Sequence Length | 44 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity).. | |
Protein Sequence | MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSDKPGMAE ------CCCCCCHHH | 55.10 | 29396449 | |
4 | Acetylation | ----MSDKPGMAEIE ----CCCCCCHHHHH | 35.84 | 23749302 | |
12 | Acetylation | PGMAEIEKFDKSKLK CCHHHHHHHCHHHHC | 65.60 | 23749302 | |
15 | Acetylation | AEIEKFDKSKLKKTE HHHHHHCHHHHCCCC | 53.26 | 21339330 | |
16 | Phosphorylation | EIEKFDKSKLKKTET HHHHHCHHHHCCCCC | 45.10 | 26074081 | |
17 | Acetylation | IEKFDKSKLKKTETQ HHHHCHHHHCCCCCC | 70.80 | 21466224 | |
19 | Acetylation | KFDKSKLKKTETQEK HHCHHHHCCCCCCCC | 62.48 | 21466224 | |
21 | Phosphorylation | DKSKLKKTETQEKNP CHHHHCCCCCCCCCC | 42.55 | 26074081 | |
23 | Phosphorylation | SKLKKTETQEKNPLS HHHCCCCCCCCCCCC | 47.46 | 26074081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TYB4Y_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TYB4Y_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TYB4Y_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TYB4Y_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...