UniProt ID | MDFI_HUMAN | |
---|---|---|
UniProt AC | Q99750 | |
Protein Name | MyoD family inhibitor | |
Gene Name | MDFI | |
Organism | Homo sapiens (Human). | |
Sequence Length | 246 | |
Subcellular Localization | Nucleus. Cytoplasm. | |
Protein Description | Inhibits the transactivation activity of the Myod family of myogenic factors and represses myogenesis. Acts by associating with Myod family members and retaining them in the cytoplasm by masking their nuclear localization signals. Can also interfere with the DNA-binding activity of Myod family members. Plays an important role in trophoblast and chondrogenic differentiation. Regulates the transcriptional activity of TCF7L1/TCF3 by interacting directly with TCF7L1/TCF3 and preventing it from binding DNA. Binds to the axin complex, resulting in an increase in the level of free beta-catenin. Affects axin regulation of the WNT and JNK signaling pathways (By similarity).. | |
Protein Sequence | MYQVSGQRPSGCDAPYGAPSAAPGPAQTLSLLPGLEVVTGSTHPAEAAPEEGSLEEAATPMPQGNGPGIPQGLDSTDLDVPTEAVTCQPQGNPLGCTPLLPNDSGHPSELGGTRRAGNGALGGPKAHRKLQTHPSLASQGSKKSKSSSKSTTSQIPLQAQEDCCVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCLCCCCCGSGECADCDLPCDLDCGILDACCESADCLEICMECCGLCFSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
129 | Ubiquitination | GGPKAHRKLQTHPSL CCHHHHHHHHCCHHH | 34.77 | - | |
132 | Phosphorylation | KAHRKLQTHPSLASQ HHHHHHHCCHHHHHC | 46.30 | 23927012 | |
135 | Phosphorylation | RKLQTHPSLASQGSK HHHHCCHHHHHCCCC | 29.03 | 23927012 | |
138 | Phosphorylation | QTHPSLASQGSKKSK HCCHHHHHCCCCCCC | 40.13 | 20873877 | |
141 | Phosphorylation | PSLASQGSKKSKSSS HHHHHCCCCCCCCCC | 29.31 | 20873877 | |
142 | Ubiquitination | SLASQGSKKSKSSSK HHHHCCCCCCCCCCC | 68.81 | - | |
143 | Acetylation | LASQGSKKSKSSSKS HHHCCCCCCCCCCCC | 65.89 | 20167786 | |
144 | Phosphorylation | ASQGSKKSKSSSKST HHCCCCCCCCCCCCC | 41.32 | 27282143 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MDFI_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MDFI_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MDFI_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...