| UniProt ID | ZN578_HUMAN | |
|---|---|---|
| UniProt AC | Q96N58 | |
| Protein Name | Zinc finger protein 578 | |
| Gene Name | ZNF578 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 590 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May be involved in transcriptional regulation.. | |
| Protein Sequence | MLHEEAAQKRKGKEPGMALPQGRLTFRDVAIEFSLAEWKFLNPAQRALYREVMLENYRNLEAVDISSKRMMKEVLSTGQGNTEVIHTGMLQRHESYHTGDFCFQEIEKDIHDFEFQSQKDERNGHEASMPKIKELMGSTDRHDQRHAGNKPIKDQLGLSFHLHLPELHIFQPEEKIANQVEKSVNDASSISTSQRISCRPETHTPNNYGNNFFHSSLLTQKQEVHMREKSFQCNETGEAFNCSSFVRKHQIIHLGEKQYKFDICGKVFNEKRYLARHRRCHTSEKPYKCNECGKSFSYKSSLTCHRRCHTGEKPYKCNECGKSFSYKSSLTCHHRCHTGEKPYKCNECGKSFSYKSSLRCHRRLHTGIKPYKCNECGKMFGQNSTLVIHKAIHTGEKPYKCNECGKAFNQQSHLSRHHRLHTGEKPYKCNDCGKAFIHQSSLARHHRLHTGEKSYKCEECDRVFSQKSNLERHKIIHTGEKPYKCNECHKTFSHRSSLPCHRRLHSGEKPYKCNECGKTFNVQSHLSRHHRLHTGEKPYKCKVCDKAFMCHSYLANHTRIHSGEKPYKCNECGKAHNHLIDSSIKPCMSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 150 | Ubiquitination | DQRHAGNKPIKDQLG CCCCCCCCCHHHHHC | 54.86 | - | |
| 159 | Phosphorylation | IKDQLGLSFHLHLPE HHHHHCCEEEEECCC | 18.41 | - | |
| 192 | Phosphorylation | NDASSISTSQRISCR HCCHHCCCCCCEECC | 13.67 | - | |
| 193 | Phosphorylation | DASSISTSQRISCRP CCHHCCCCCCEECCC | 32.65 | - | |
| 288 | Sumoylation | HTSEKPYKCNECGKS CCCCCCEECCCCCCC | 4.23 | - | |
| 288 | Sumoylation | HTSEKPYKCNECGKS CCCCCCEECCCCCCC | 4.23 | - | |
| 295 | Phosphorylation | KCNECGKSFSYKSSL ECCCCCCCCCCCCCC | 10.85 | - | |
| 300 | Phosphorylation | GKSFSYKSSLTCHRR CCCCCCCCCCEECCC | 15.67 | - | |
| 316 | Sumoylation | HTGEKPYKCNECGKS CCCCCCEECCCCCCC | 3.09 | - | |
| 316 | Sumoylation | HTGEKPYKCNECGKS CCCCCCEECCCCCCC | 3.09 | - | |
| 323 | Phosphorylation | KCNECGKSFSYKSSL ECCCCCCCEECCCCC | 7.08 | - | |
| 328 | Phosphorylation | GKSFSYKSSLTCHHR CCCEECCCCCEECCC | 6.03 | - | |
| 344 | Sumoylation | HTGEKPYKCNECGKS CCCCCCEECCCCCCC | 4.23 | - | |
| 344 | Sumoylation | HTGEKPYKCNECGKS CCCCCCEECCCCCCC | 4.23 | - | |
| 351 | Phosphorylation | KCNECGKSFSYKSSL ECCCCCCCCCHHHHH | 26.23 | - | |
| 366 | Phosphorylation | RCHRRLHTGIKPYKC HHHHHHCCCCCCEEC | - | ||
| 369 | Sumoylation | RRLHTGIKPYKCNEC HHHCCCCCCEECCCC | - | ||
| 369 | Sumoylation | RRLHTGIKPYKCNEC HHHCCCCCCEECCCC | - | ||
| 372 | Sumoylation | HTGIKPYKCNECGKM CCCCCCEECCCCCCC | - | ||
| 372 | Sumoylation | HTGIKPYKCNECGKM CCCCCCEECCCCCCC | - | ||
| 394 | Phosphorylation | VIHKAIHTGEKPYKC EEEEEECCCCCCEEC | 29496963 | ||
| 397 | Ubiquitination | KAIHTGEKPYKCNEC EEECCCCCCEECCCH | - | ||
| 397 | Sumoylation | KAIHTGEKPYKCNEC EEECCCCCCEECCCH | - | ||
| 397 | Sumoylation | KAIHTGEKPYKCNEC EEECCCCCCEECCCH | - | ||
| 399 | Phosphorylation | IHTGEKPYKCNECGK ECCCCCCEECCCHHH | 18767875 | ||
| 400 | Sumoylation | HTGEKPYKCNECGKA CCCCCCEECCCHHHH | - | ||
| 400 | Sumoylation | HTGEKPYKCNECGKA CCCCCCEECCCHHHH | - | ||
| 422 | Phosphorylation | SRHHRLHTGEKPYKC HHCCCCCCCCCCCCC | 27422710 | ||
| 425 | Sumoylation | HRLHTGEKPYKCNDC CCCCCCCCCCCCCCC | - | ||
| 425 | Ubiquitination | HRLHTGEKPYKCNDC CCCCCCCCCCCCCCC | - | ||
| 425 | Sumoylation | HRLHTGEKPYKCNDC CCCCCCCCCCCCCCC | - | ||
| 450 | Phosphorylation | ARHHRLHTGEKSYKC HHHCCCCCCCCCCCH | 21857030 | ||
| 474 | Ubiquitination | KSNLERHKIIHTGEK CCCHHHCCEEECCCC | - | ||
| 478 | Phosphorylation | ERHKIIHTGEKPYKC HHCCEEECCCCCEEC | 29496963 | ||
| 481 | Ubiquitination | KIIHTGEKPYKCNEC CEEECCCCCEECCCC | - | ||
| 506 | Phosphorylation | PCHRRLHSGEKPYKC CCCCCCCCCCCCEEC | 27794612 | ||
| 512 | Sumoylation | HSGEKPYKCNECGKT CCCCCCEECCCCCCE | - | ||
| 512 | Sumoylation | HSGEKPYKCNECGKT CCCCCCEECCCCCCE | - | ||
| 534 | Phosphorylation | SRHHRLHTGEKPYKC HHCCCCCCCCCCCCC | 27422710 | ||
| 537 | Sumoylation | HRLHTGEKPYKCKVC CCCCCCCCCCCCCCC | - | ||
| 537 | Ubiquitination | HRLHTGEKPYKCKVC CCCCCCCCCCCCCCC | - | ||
| 537 | Sumoylation | HRLHTGEKPYKCKVC CCCCCCCCCCCCCCC | - | ||
| 562 | Phosphorylation | ANHTRIHSGEKPYKC CCCCCCCCCCCCEEC | 29496963 | ||
| 568 | Sumoylation | HSGEKPYKCNECGKA CCCCCCEECCCCCHH | - | ||
| 568 | Sumoylation | HSGEKPYKCNECGKA CCCCCCEECCCCCHH | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN578_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN578_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN578_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
| KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
| KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
