| UniProt ID | OTX1_HUMAN | |
|---|---|---|
| UniProt AC | P32242 | |
| Protein Name | Homeobox protein OTX1 | |
| Gene Name | OTX1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 354 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.. | |
| Protein Sequence | MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSSSASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPASISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MMSYLKQPPY -----CCCCCCCCCC | 26.47 | 23607784 | |
| 4 | Phosphorylation | ----MMSYLKQPPYG ----CCCCCCCCCCC | 10.46 | 23607784 | |
| 10 | Phosphorylation | SYLKQPPYGMNGLGL CCCCCCCCCCCCCCC | 35.37 | 23607784 | |
| 28 | Phosphorylation | AMDLLHPSVGYPATP HHHHHCCCCCCCCCC | 19.89 | 23607784 | |
| 31 | Phosphorylation | LLHPSVGYPATPRKQ HHCCCCCCCCCCCHH | 6.37 | 23607784 | |
| 34 | Phosphorylation | PSVGYPATPRKQRRE CCCCCCCCCCHHHHH | 21.08 | 23607784 | |
| 99 | Phosphorylation | KCRQQQQSGSGTKSR HHHHHHHCCCCCCCC | 30.50 | 23312004 | |
| 101 | Phosphorylation | RQQQQSGSGTKSRPA HHHHHCCCCCCCCCC | 48.84 | 23312004 | |
| 103 | Phosphorylation | QQQSGSGTKSRPAKK HHHCCCCCCCCCCCC | 27.78 | 23312004 | |
| 105 | Phosphorylation | QSGSGTKSRPAKKKS HCCCCCCCCCCCCCC | 43.25 | 23312004 | |
| 181 | Phosphorylation | SSIWSPASISPGSAP HHCCCCCCCCCCCCC | 27.30 | 26074081 | |
| 183 | Phosphorylation | IWSPASISPGSAPAS CCCCCCCCCCCCCCC | 22.25 | 26074081 | |
| 186 | Phosphorylation | PASISPGSAPASVSV CCCCCCCCCCCCCCC | 34.17 | 26074081 | |
| 190 | Phosphorylation | SPGSAPASVSVPEPL CCCCCCCCCCCCCCC | 17.54 | 26074081 | |
| 192 | Phosphorylation | GSAPASVSVPEPLAA CCCCCCCCCCCCCCC | 29.47 | 26074081 | |
| 337 | Phosphorylation | AWKLNFNSPDCLDYK HHCCCCCCCCCCCCC | 20.27 | 21815630 | |
| 344 | Sumoylation | SPDCLDYKDQASWRF CCCCCCCCHHHHEEE | 42.93 | 28112733 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OTX1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OTX1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OTX1_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
