| UniProt ID | MGT5B_HUMAN | |
|---|---|---|
| UniProt AC | Q3V5L5 | |
| Protein Name | Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B | |
| Gene Name | MGAT5B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 792 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein. |
|
| Protein Description | Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAcbeta1,2-Manalpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAcbeta1,2-Manalpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway.. | |
| Protein Sequence | MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTEVMGGPESRGVLRKMSDLLELMVKRMDALARLENSSELHRAGGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILRHSLLLHSKVSEGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNLGVPPGRGSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTNWGYWNLNPKQFMTMFPHTPDNSFMGFVSEELNETEKRLIKGGKASNMAVVYGKEASIWKLQGKEKFLGILNKYMEIHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGCIFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYNNSEEFEAAIKAIMRTQVDPYLPYEYTCEGMLERIHAYIQHQDFCRAPDPALPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRACTDTCLDHGLICEPSFFPFLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTKYRRLCPCRDFRKGQVALCQGCL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MITVNPDGKI -----CEEECCCCCE | 16.97 | 24719451 | |
| 56 | Phosphorylation | RLGDSPFTIRTEVMG HHCCCCCEEEEEECC | 16.97 | 24719451 | |
| 75 | Phosphorylation | RGVLRKMSDLLELMV HHHHHHHHHHHHHHH | 28.30 | - | |
| 94 | Phosphorylation | ALARLENSSELHRAG HHHHHHCHHHHHHCC | 18.80 | - | |
| 127 | N-linked_Glycosylation | RIQAIAQNVSDIAVK HHHHHHHCHHHHHHH | 26.66 | UniProtKB CARBOHYD | |
| 259 | Ubiquitination | IFMKKRTKRLTAQWA EEEEHHHHHHHHHHH | 49.82 | 29967540 | |
| 270 | Ubiquitination | AQWALAAQRLAQKLG HHHHHHHHHHHHHHC | 35.00 | 29967540 | |
| 275 | Ubiquitination | AAQRLAQKLGATQRD HHHHHHHHHCCCHHH | 43.19 | 29967540 | |
| 286 | Ubiquitination | TQRDQKQILVHIGFL CHHHHHHHEEEEEEE | 5.82 | 29967540 | |
| 368 | Phosphorylation | FDLIYTDYHGLQQMK CCEEEECCHHHHHHH | 7.03 | - | |
| 381 | Phosphorylation | MKRHMGLSFKKYRCR HHHHHCCCCCCEEEE | 29.32 | 24719451 | |
| 449 (in isoform 5) | Phosphorylation | - | 45.81 | 22468782 | |
| 460 (in isoform 2) | Phosphorylation | - | 30.53 | 22468782 | |
| 466 (in isoform 5) | Phosphorylation | - | 18.84 | 22468782 | |
| 477 (in isoform 2) | Phosphorylation | - | 50.99 | 22468782 | |
| 480 | Ubiquitination | WKLQGKEKFLGILNK EEECCHHHHHHHHHH | 49.75 | 29967540 | |
| 771 | Phosphorylation | CAGSNTKYRRLCPCR CCCCCCCCEEECCCC | 10.03 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MGT5B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MGT5B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MGT5B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KR195_HUMAN | KRTAP19-5 | physical | 25416956 | |
| KLH38_HUMAN | KLHL38 | physical | 25416956 | |
| KR122_HUMAN | KRTAP12-2 | physical | 25416956 | |
| KR261_HUMAN | KRTAP26-1 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...