RGS17_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RGS17_HUMAN
• UniProt AC: Q9UGC6
• Protein Name: Regulator of G-protein signaling 17
• Gene Name: RGS17
• Organism: Homo sapiens (Human).
• Sequence Length: 210
• Subcellular Localization: Membrane . Cell junction, synapse, synaptosome . Nucleus . Cytoplasm .
• Protein Description: Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. [PubMed: 15096504 Binds selectively to GNAZ and GNAI2 subunits, accelerates their GTPase activity and regulates their signaling activities. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins (By similarity]
• Protein Sequence: MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
137	Phosphorylation	EEKARMIYEDYISIL HHHHHHHHHHHHHHH	8.07	22817900
145	Phosphorylation	EDYISILSPKEVSLD HHHHHHHCHHHCCCC	32.05	24719451
150	Phosphorylation	ILSPKEVSLDSRVRE HHCHHHCCCCHHHHH	27.79	27470641
171	Phosphorylation	LDPNPHMYEDAQLQI CCCCCCCCCCHHHHH	13.97	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RGS17_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RGS17_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RGS17_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NUFP2_HUMAN	NUFIP2	physical	25416956
DHX37_HUMAN	DHX37	physical	25416956
TBC16_HUMAN	TBC1D16	physical	25416956
LCE4A_HUMAN	LCE4A	physical	25416956
LCE2A_HUMAN	LCE2A	physical	25416956
LCE3C_HUMAN	LCE3C	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.