CHIC2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CHIC2_HUMAN
• UniProt AC: Q9UKJ5
• Protein Name: Cysteine-rich hydrophobic domain-containing protein 2
• Gene Name: CHIC2
• Organism: Homo sapiens (Human).
• Sequence Length: 165
• Subcellular Localization: Cell membrane . Cytoplasmic vesicle . Also present at a Golgi-like vesicular compartment and at scattered vesicles.
• Protein Sequence: MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MADFDEIYEEEEDEE CCCHHHHHCCHHHHH	18.42	27642862
24	Ubiquitination	ALEEQLLKYSPDPVV HHHHHHHHHCCCCEE	52.88	29967540
76	Ubiquitination	NRVNSCLKKNLPVNV HHHHHHHHHCCCCCH	43.90	23000965
77	Ubiquitination	RVNSCLKKNLPVNVR HHHHHHHHCCCCCHH	51.25	23000965
89	Ubiquitination	NVRWLLCGCLCCCCT CHHHHHHHHHHHHHH	13.85	23000965
117	Neddylation	RTRRSIEKLLEWENN HHHHHHHHHHHHHHH	57.62	32015554
117	Ubiquitination	RTRRSIEKLLEWENN HHHHHHHHHHHHHHH	57.62	23000965
127	Phosphorylation	EWENNRLYHKLCLHW HHHHHHHHHHHHHHH	8.15	30576142
137	Phosphorylation	LCLHWRLSKRKCETN HHHHHHHHCCCCCCC	23.11	30576142
159	Phosphorylation	LIEFLPKTPIFRPD- HHHCCCCCCCCCCC-	21.48	30266825

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CHIC2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CHIC2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CHIC2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR412_HUMAN	KRTAP4-12	physical	16189514
CTSR1_HUMAN	CATSPER1	physical	16189514
PKHF2_HUMAN	PLEKHF2	physical	16189514
GMCL1_HUMAN	GMCL1	physical	25416956
CEP44_HUMAN	CEP44	physical	25416956
KRA42_HUMAN	KRTAP4-2	physical	25416956
K1C40_HUMAN	KRT40	physical	25416956
SPERT_HUMAN	SPERT	physical	25416956
KR107_HUMAN	KRTAP10-7	physical	25416956
KR109_HUMAN	KRTAP10-9	physical	25416956
KR101_HUMAN	KRTAP10-1	physical	25416956
KR108_HUMAN	KRTAP10-8	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956
UBE2N_HUMAN	UBE2N	physical	27173435

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.